KEGG   Lactobacillus helveticus R0052: R0052_04980Help
Entry
R0052_04980       CDS       T02217                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R0052_04980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R0052_04980
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    R0052_04980
Enzymes [BR:lhr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     R0052_04980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(875515..877005)
Genome map
AA seq 496 aa AA seqDB search
MKYRSTRGSKENTLNSAAAIIQGLAPDGGLYVPLDFPKANFKLEDLPKLSYKQIAAMVIS
LFFNDYSKEQIQSAVLNAYSEQWDYRSIVPIEKHDHNFYMELFHGPTLAFKDIALQILPQ
LMTRAVQIEKIDRNIIILTATSGDTGTASMRGFANQKCTSVIVFYPEGDVSPVQLRQMLS
QHGDNLQAIAIKGNFDDAQTEVKKIFNDEKFKTLLNKNGYQFSSANSMNIGRLVPQISYY
LYTYGQLVRRQEIKLGNEINFSVPTGNFGDILAGYYAKKLGLPIKKLICASNENNVLTDF
FKNGEYDRRRKFHLTNAPAMDILVSNNLERLLFDLYDNDYKQISSLMNQLTQRGHYQISD
EVHAKLQEIFAADFATERQVIKEINRIYNYDRYLIDPHTAVGSYVAHQYQEKTGDTTPMV
IVSTASPYKFPETVYEAVTGRVCPQTGVAAIKKLHEELGGQLSIGVRTLFDRKPGLEKVI
DPQNMEIVISSILDLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactcgaggttcaaaagaaaatactttaaattcagctgctgctatt
attcagggattagctcctgatggtggattatatgttccactggattttcctaaggctaat
tttaaattagaagatttaccaaaattatcttataaacagatagccgcaatggtaattagc
ttattttttaatgattattctaaagaacaaatacaaagcgctgtacttaacgcatatagt
gaacaatgggactaccgcagcattgtccctattgaaaagcatgatcataatttctacatg
gaattattccacggaccaactcttgcttttaaagatattgctttacaaatcttgccccaa
ttaatgactcgagctgtacaaattgaaaaaattgatcgcaatattatcatcttgactgct
acttctggagatacaggtacagcttccatgcgcggatttgctaatcaaaaatgcactagc
gtgattgtcttctatccagaaggcgatgttagtccagtacagcttcgtcaaatgctcagt
cagcatggcgacaatttacaagcaattgctattaaagggaactttgacgatgcccaaacc
gaagtaaagaaaattttcaacgatgagaaatttaaaactttattaaataaaaacggctat
caattctcctctgctaattcaatgaacattggtcgacttgtccctcaaatttcttattat
ctttacacatacggtcaattagtgcgaagacaagaaatcaaattaggcaatgaaattaac
ttttctgtacctacaggtaattttggggatattttagctggctactatgccaaaaagtta
ggattaccaattaaaaaattaatttgtgcttcaaatgaaaacaatgttcttaccgatttc
tttaaaaatggtgaatatgaccgtcgtcgcaaattccatttaaccaacgcacctgcaatg
gatatcttggtttctaacaatcttgaacggctcttgtttgatctttacgataatgactac
aaacaaattagcagcttgatgaatcaactgactcaacggggccactatcaaatcagtgat
gaagttcacgccaaacttcaagaaatctttgccgctgattttgcaacagaaagacaagtt
attaaagaaatcaatcgcatctataattatgaccgttacttaattgatccccatactgcg
gttggttcttatgttgctcaccaatatcaagaaaagaccggtgatacaacgcctatggta
attgtatcaactgctagtccatataaattcccagaaacagtatatgaagcagtaactggt
cgcgtgtgccctcaaacaggagttgcagctatcaagaagctccatgaggaattaggtggt
caattatcaattggagtgcggaccttatttgatcgtaaacccggcttggaaaaagtaatc
gatccacaaaatatggaaatagtaattagctcaattttagacttaaaataa

DBGET integrated database retrieval system