KEGG   Lactobacillus helveticus R0052: R0052_06785Help
Entry
R0052_06785       CDS       T02217                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    R0052_06785
   01230 Biosynthesis of amino acids
    R0052_06785
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R0052_06785
   00030 Pentose phosphate pathway
    R0052_06785
   00051 Fructose and mannose metabolism
    R0052_06785
   00052 Galactose metabolism
    R0052_06785
  Energy metabolism
   00680 Methane metabolism
    R0052_06785
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    R0052_06785
Enzymes [BR:lhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     R0052_06785
Protein phosphatases and associated proteins [BR:lhr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     R0052_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1180299..1181261)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHK
ISEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRV
GVASGADAIVIPERPYDVKEIAETITRGFADGKDHGIIVLAEGVMTADKFKDELLKYGDF
DARANVLAHMQRGGSPTVTDRVNATKMGNYAVKLLLDGKGGLAVGMENGQLSTHDILDLF
DGKHHGDYALLDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggcggagacgcccctggtatgaatgcagcaatt
agagctgtcaccaagactgctatccatcatggacttgaagtctttggaattcgttatggt
ttcgctggtttggttgcaggtgactttgttccgcttactacggaaaatgttgaccacaag
ataagtgaaggcggtacatttttgtacagtgcccgcttccctgaatttgcacaagaagaa
gtgcaacaaaagggtgttgagcaattgaagaaacatggtattgatgctgttatcgttatt
ggcggtgacggatcttaccacggtgctttagccttgactcgccacggcgtaaactcagtt
ggtttaccagggactatcgataatgatattccttataccgactacacgattggctttgat
tctgcttgtcgtactgctatggacgcaattgataagattcgcgacacagcaagtagtcac
caccgcgttttcgttgttaacgtaatgggacgtgaatgtggtgatatcgctatgcgtgtt
ggtgtagctagtggtgcagatgcaattgttattcctgaacgtccatacgacgttaaagaa
attgcagaaactatcactcgtggttttgcagatggcaaagatcatggtatcattgtttta
gcagaaggtgtcatgaccgctgataagtttaaggatgaattacttaaatacggcgatttt
gatgctcgtgctaatgtccttgcgcatatgcaacgtggtggctcaccaacagtcacagat
agagttaatgctactaagatgggtaactatgctgttaagttgcttctcgatgggaagggc
ggtttagctgtcggcatggagaatggtcaacttagtacccacgacattcttgatctgttt
gacggaaaacaccatggcgattatgcgttattggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system