KEGG   Lactobacillus helveticus R0052: R0052_07315Help
Entry
R0052_07315       CDS       T02217                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R0052_07315
Enzymes [BR:lhr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     R0052_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1279223..1280668
Genome map
AA seq 481 aa AA seqDB search
MYSAKMPKNFLWGGAVAAHQLEGAWKEGGKGVSVADVMTVGSATKPREITDGVLPGKNYP
NHSAIDFYHHYKEDIKLMAEMGFKAFRTSIAWTRIFPNGDEKEPNEEGLKFYDDLFDTCH
KYGIEPVITLSHFEMPFNLAKNYGGFTNRKVIDFFVRFAEVCFKRYKNKVKYWMTFNEID
NQSAFNNDFLMATNSGILFKDGMTDHDKEAAMYQAGHYELVASALAVKIGHKINPNFQIG
CMINYSPVRPLTPSSDDVLLADKWEQRRDWFSDVHVFGEYPNAVEAYIERNGYRPDITDE
DRIVLKEGTVDYVGFSYYQTTTVSSEEVKPDDLTDLAKAVAKNPTLKRSDWGWEIDPEGL
RIALNQLQDRYHKPLFIVENGLGAYDKVENGKVHDDYRIDYLRNHISEMEKAVELDGIDL
MGYLPWGCIDLVSAGTGQMDKRYGFIYVDKNDAGEGTLARSRKDSFFWYKKVIESNGKDL
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtattcagcaaaaatgccaaaaaactttttatggggtggcgctgtagctgctcaccaa
cttgaaggtgcttggaaagaaggcggcaaaggagtttctgttgccgatgttatgactgtt
ggttctgctactaaaccacgtgaaatcactgatggcgtgcttccaggcaagaactatcct
aaccactcagctattgatttctaccaccactacaaggaagatattaagttaatggctgaa
atgggctttaaagctttcagaacttccattgcttggactagaattttccctaatggtgac
gaaaaagaacctaatgaagaaggtttgaagttttatgacgatttatttgatacctgtcat
aaatatggcattgagcctgtaattaccctctcccactttgaaatgccattcaaccttgct
aagaactacggtggttttaccaatcgtaaggtaatcgacttctttgtacgttttgcagaa
gtttgcttcaagcgttacaagaacaaggttaagtactggatgactttcaacgaaatcgat
aatcaatcagcatttaacaatgacttcttaatggctactaactcaggcattcttttcaag
gatggtatgactgaccatgataaggaagctgcaatgtatcaagctgggcactacgaatta
gttgcttccgcattagctgttaagattggccacaagatcaaccctaacttccaaattggt
tgtatgatcaactactcacctgttcgtccacttactccatcaagtgacgatgttctttta
gctgataaatgggaacaacgtcgtgattggttctcagacgttcacgtttttggtgaatat
ccaaatgcagttgaagcttatattgaaagaaatggctaccgtcctgacatcactgatgaa
gacagaattgtcttaaaggaaggtaccgttgactatgttggcttcagctactaccaaact
actacagtttcaagcgaagaagttaagcctgatgacttaactgatttggcaaaagctgta
gctaagaaccctactttgaagcgtagtgactggggttgggaaattgacccagaaggtttg
agaattgccttaaaccaattgcaagatcgttaccacaagccactattcatcgttgaaaat
ggtcttggtgcttacgacaaggttgaaaacggcaaggttcatgatgactacagaatcgac
tacttaagaaaccacatttcagaaatggaaaaggctgttgaactcgatggtatcgactta
atgggttaccttccatggggatgcatcgacttagtttctgctggtactggtcaaatggac
aagcgttacggctttatctatgttgataagaatgatgccggtgaaggtaccttagcacgt
tcacgtaaggattcattcttctggtacaagaaggtcatcgaatcaaacggtaaagactta
gactaa

DBGET integrated database retrieval system