KEGG   Lactobacillus helveticus R0052: R0052_08305Help
Entry
R0052_08305       CDS       T02217                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    R0052_08305
Enzymes [BR:lhr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     R0052_08305
Exosome [BR:lhr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R0052_08305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1468440..1470356)
Genome map
AA seq 638 aa AA seqDB search
MEILEERYRKFGAGTELKLQDILGCHQIDRNFRFSVWAPKARQVWLVGDFNDWQKTLPMS
ENEQGIWTVITDQPQIGQLYKFLVKQADGTEVMKIDPMATQFEHRPGDAAVVANLPEKHW
HDAAWIGRNKQMNHFARPINIYEVHASSWKRHADGSLYTLKDLQKELIPYVQKQGFNYIE
FLPLTEHPLDASWGYQATGYFALCSTYGTPSELQDFVEACHQHNIGVFCDWVPGHFCINN
DALAYYDGTPCYEFAEKWRAENKGWGALNFDLGKPQVQSFLLSSALFWLEYYHLDGLRVD
AVSNMLYRDYDRGPGQWQPDKYGGNRNLEGIEFLHKLNRTVKGLHPEDLMIAEESSAQVK
ITGRIEDGGLGFDFKWNMGWMNDVLRFYEMDPLFRKFNFNLATFSFMYRMSENFVLPLSH
DEVVHGKRSLMNKMWGKRDQQFAQLRNLYTMLMTYPGKKLLFMGSEFGQYLEWRFNEGLE
WSELQDPLNNKMRRFDRVLNQFYLDEPSLWQLEQKKTALKVIDADNKDESVLSFIRQGKR
RKDFLVIILNFTPVERKKFAIGVPYSGEYKEVLNTARVEFGGHWNQAAQICTTVKKQFKN
MEYQVELDVPGFSALILKPKEVNIKRHLRRKHSQRGGK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcttgaagaacggtatcgcaaattcggcgctggtactgagcttaagctacag
gatattttgggttgtcatcagatagatcgtaacttcaggttcagtgtttgggcaccaaaa
gcacgccaagtttggttagttggcgactttaatgattggcaaaagactttgccaatgtca
gaaaatgaacaaggaatttggacagttattactgatcagccccagattggccaactttat
aaatttttggttaagcaagctgatggtacagaagtcatgaagattgatccaatggcaacg
caatttgaacatcgtccgggggatgctgcagttgtagcgaatttgccagaaaagcactgg
cacgatgctgcttggattggcagaaacaagcagatgaatcattttgctaggccaatcaat
atttatgaagtgcacgctagctcatggaagagacatgctgatggttcactttatacattg
aaagatttacaaaaagaattaattccttatgtgcaaaaacaaggttttaattatattgaa
tttctgccattaactgagcatccacttgatgcttcttgggggtatcaggcaacgggctat
tttgcattatgtagtacatatggtacgcctagtgaattgcaagacttcgtagaggcttgt
caccagcataatatcggagttttttgcgattgggtaccagggcatttttgtattaataat
gatgctttggcatattatgacggtacgccttgttatgaatttgcagaaaaatggcgtgct
gaaaataaaggctggggcgcacttaattttgatttaggtaagccgcaagtacaatcattt
ttgctttcaagcgcattattctggctagaatattatcatttagatggtctgcgtgtagat
gcggtatctaatatgctttaccgcgattatgatcgcgggcctggtcaatggcaaccagat
aagtatggcggcaatcgtaacttagaggggattgaatttttgcataagctgaaccgtacg
gtgaagggtttgcatccagaggatttgatgattgctgaagaaagttcagctcaagttaag
attacaggccgaattgaagatggcgggttaggctttgattttaaatggaatatggggtgg
atgaatgatgttttacgtttctatgaaatggatcctttatttagaaaattcaacttcaat
ttagccaccttttcgtttatgtatcggatgagtgaaaattttgttttgccattatcgcat
gatgaagttgtgcatggtaaacgaagtttaatgaataagatgtggggcaagcgtgatcaa
caatttgctcaattgcggaatttatataccatgctgatgacctatccaggcaaaaagctc
ttgtttatggggagtgaatttgggcaatacttggaatggcgctttaatgaaggacttgaa
tggtctgaattacaagatcctttgaataataagatgcgaagatttgatcgtgtcttgaac
caattctatttggatgagccgtcattatggcaattagagcaaaagaaaactgctttaaag
gtaattgatgctgataataaggatgagtcagttctatcttttattcgtcaagggaagcga
agaaaggatttcttagttatcattctgaactttacaccggtagagcgaaagaagtttgca
attggcgtgccatattcaggtgagtacaaggaagtgttgaatactgctcgagtagagttt
ggtggtcattggaatcaagcagcgcaaatttgcacgacggtaaagaagcagtttaagaat
atggaatatcaagttgaacttgatgtccctggatttagtgcattgatcttgaaacctaaa
gaggtcaatattaagagacatctacggcgcaaacatagtcaaagaggagggaagtaa

DBGET integrated database retrieval system