KEGG   Lactobacillus helveticus R0052: R0052_10320Help
Entry
R0052_10320       CDS       T02217                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00230  Purine metabolism
lhr01100  Metabolic pathways
Module
lhr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    R0052_10320
Enzymes [BR:lhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     R0052_10320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ABC_tran AAA_17 AAA_22 AAA_23 Rad17 RsgA_GTPase Zeta_toxin AAA_24 dNK PRK AAA_29 AAA_14 AAA_16 AAA_28 PduV-EutP ATPase AAA_5 TsaE Cytidylate_kin APS_kinase T2SSE CPT
Motif
Other DBs
NCBI-ProteinID: AFR22779
UniProt: J7LMF4
Position
complement(1837704..1838249)
Genome map
AA seq 181 aa AA seqDB search
MKKIILIAGPSGAGKTTISDYLNEKYGIPRVLTHTTRPMRPGEKQNFSYHFETDESFKTL
HFFEHIRYGSYQYGSSREALNLAWKKSDLVSLIVDIKGVYTYLKQLGNKVYFLYVTTSTK
EELKERLLKRGDDPEKIKERLSGSELNLLPEDLKEYAHILVNDNLSETKSKLDSILSRLE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaataattttaatcgcgggcccgagcggtgccggaaagacaacgatttctgat
tatttaaatgaaaaatatggtataccgcgtgtcttgacacatacgacgcgtccaatgaga
ccaggggaaaagcagaatttctcctatcattttgaaacggatgaaagcttcaagacactg
cacttttttgaacatattagatatgggtcttatcaatatggttcaagtcgtgaagcctta
aacctcgcttggaaaaaaagtgatctcgtttctttaattgtcgatattaaaggtgtttac
acttatctaaaacaattaggtaataaagtttatttcctttatgtgacaacttcgacgaag
gaagagctaaaagagcgccttttaaagcggggagacgatcccgaaaaaatcaaagagcga
ctcagcggcagtgaattaaacttattgccggaagacttgaaagaatacgctcacatatta
gttaatgataatctatcagaaactaagagtaagctggattcaatcttatcaaggcttgaa
gagtga

DBGET integrated database retrieval system