KEGG   Lactobacillus helveticus R0052: R0052_11165Help
Entry
R0052_11165       CDS       T02217                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lhr01100  Metabolic pathways
lhr01110  Biosynthesis of secondary metabolites
lhr01130  Biosynthesis of antibiotics
lhr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R0052_11165 (trpC)
Enzymes [BR:lhr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     R0052_11165 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth PDZ IMPDH
Motif
Other DBs
NCBI-ProteinID: AFR22921
UniProt: J7LI83
Position
1975812..1976591
Genome map
AA seq 259 aa AA seqDB search
MILDDLVTVTKKRLIRHQKRHSLTELKREVAAMPATTKPNFLSILKQPGLHIISEVKKAS
PSKGTIVTDFPYLKIAKAYDQAGADAISVLTEPDYFNGHLHYLKDISQAVSVPTLRKDFT
IDPYMIYEAKANGAGIILLIVAILDNQQLIAYRELAEQLGMQAIVEAYTADEVTQALKSG
AKIIGINNRNLKDFKVDFNNSLKLRAMVPQTIPVVAESGIKTKQDVKKLAAANFNAILMG
ETLMRSDQKKQLIETFKEV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagatgatctggttaccgttaccaaaaaacgattgattcgccaccaaaagcgt
cactcattaaccgaattaaaacgtgaagtcgctgccatgccggcaaccaccaagccgaat
tttctttctatcttaaagcagcccggtttacacattatttccgaagttaaaaaggcatcc
ccctcaaagggcaccatcgtcaccgatttcccctatttgaaaattgccaaggcttatgac
caggccggtgccgatgcaatctccgttttaaccgagccggattactttaacggccacctg
cactatctaaaagacatcagccaagcggtatcagttccaaccttgcgcaaagacttcaca
atcgatccttacatgatttatgaagccaaggccaacggtgccggcattattctgttgatt
gttgccattctggacaaccagcagttaattgcctaccgggaattggcagaacagttaggt
atgcaggcaatcgttgaggcctataccgctgatgaagtcacccaggcgttaaaatccggt
gctaaaatcatcggcattaataatcggaacctcaaagatttcaaagtggatttcaataac
agcttaaagttacgggcaatggtcccacaaacaatccctgtggtcgccgaaagtggcatt
aaaaccaaacaggatgttaaaaagctggcagcagccaatttcaatgccattctgatgggc
gaaaccttaatgaggtccgatcaaaaaaagcaactgattgaaacgttcaaggaggtctaa

DBGET integrated database retrieval system