KEGG   Lactobacillus helveticus R0052: R0052_11175Help
Entry
R0052_11175       CDS       T02217                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R0052_11175
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R0052_11175
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R0052_11175
Enzymes [BR:lhr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     R0052_11175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1977178..1978398
Genome map
AA seq 406 aa AA seqDB search
MKTLNEAKQNEKQTGRYGKDFGGQYIPEILMTELEKVTKVFNDLKDDPKFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAET
GAGQHGVATATIAALMGMECEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSMLLKDAV
NATLQEWASRSEDTFYVLGSAVGPAPFPAIVKHFQSVISKESKQQLQSKEGRLPDMVVAC
IGGGSNAIGSFADYIDDPSVKLVGVEGAGKGVDTDRTAATIERGTVGIFHGMKSLFMQND
DGQIDPVYSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVQAFEYIAREEGIVAAIE
SCHAVAYVEKIAPKMSKDQIIVCTLSGRGDKDVASIAKYKGVDIDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaatgaagcaaaacaaaatgaaaagcaaaccggccgttatggtaaagat
ttcggtggccaatacatccccgagatcctgatgaccgaacttgaaaaagtaactaaagtc
ttcaacgacttaaaagacgatcccaaattcaaagcagaactgaatgatctattggttaac
tacgccaatcggccatctctgctatactatgccaagaatatgaccgaagacctcggtggt
gctaaaatctacttaaaacgtgaggacttaaaccataccggtgctcacaagattaataac
gttattggtcaggcactgctggccaagcacttgggtaaaaaacgcttaatcgctgaaacc
ggtgccggccaacatggtgttgccaccgcaacgattgccgccttaatggggatggaatgt
gaaatcttcatgggcaaggaagataccgaccgtcaaaagctaaacgtttatcgaatggaa
cttcttggcgccaaggttcatccggtcacaagcggttcaatgcttctaaaagatgccgtt
aacgcaactttgcaggagtgggccagccgaagtgaagacacattctatgtgctgggttca
gctgttggaccggcaccattcccagccattgtcaaacacttccaaagcgttatttcaaag
gaatccaaacagcagctccaaagcaaggaaggccgactgccggatatggttgttgcctgt
atcggtggcggtagtaatgccattggcagctttgcagactatatcgatgacccatccgtt
aaattagtcggtgttgaaggtgccggcaaaggtgtcgatactgatcggactgctgctact
atcgaacggggaacggttggtattttccacggcatgaaatcactgttcatgcaaaacgat
gacggtcaaattgatccggtttactcaatttcagccggtttggattacccgggtgtcggt
ccggaacacgcggcgcttgcccaggaaggccgggcgcaatacgttgggattaccgatgat
gaagctgttcaggcattcgaatacattgcccgggaagaaggcattgtagccgcaattgaa
agttgccatgccgttgcctacgttgaaaaaattgcgccaaagatgtccaaagatcaaatt
attgtctgcaccctctccgggcgtggtgacaaggatgtcgcaagcatcgccaaatataaa
ggagtggacattgatgagtaa

DBGET integrated database retrieval system