KEGG   Lactobacillus helveticus R0052: R0052_11175Help
Entry
R0052_11175       CDS       T02217                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R0052_11175
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R0052_11175
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R0052_11175
Enzymes [BR:lhr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     R0052_11175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1977178..1978398
Genome map
AA seq 406 aa AA seqDB search
MKTLNEAKQNEKQTGRYGKDFGGQYIPEILMTELEKVTKVFNDLKDDPKFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAET
GAGQHGVATATIAALMGMECEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSMLLKDAV
NATLQEWASRSEDTFYVLGSAVGPAPFPAIVKHFQSVISKESKQQLQSKEGRLPDMVVAC
IGGGSNAIGSFADYIDDPSVKLVGVEGAGKGVDTDRTAATIERGTVGIFHGMKSLFMQND
DGQIDPVYSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVQAFEYIAREEGIVAAIE
SCHAVAYVEKIAPKMSKDQIIVCTLSGRGDKDVASIAKYKGVDIDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaatgaagcaaaacaaaatgaaaagcaaaccggccgttatggtaaagat
ttcggtggccaatacatccccgagatcctgatgaccgaacttgaaaaagtaactaaagtc
ttcaacgacttaaaagacgatcccaaattcaaagcagaactgaatgatctattggttaac
tacgccaatcggccatctctgctatactatgccaagaatatgaccgaagacctcggtggt
gctaaaatctacttaaaacgtgaggacttaaaccataccggtgctcacaagattaataac
gttattggtcaggcactgctggccaagcacttgggtaaaaaacgcttaatcgctgaaacc
ggtgccggccaacatggtgttgccaccgcaacgattgccgccttaatggggatggaatgt
gaaatcttcatgggcaaggaagataccgaccgtcaaaagctaaacgtttatcgaatggaa
cttcttggcgccaaggttcatccggtcacaagcggttcaatgcttctaaaagatgccgtt
aacgcaactttgcaggagtgggccagccgaagtgaagacacattctatgtgctgggttca
gctgttggaccggcaccattcccagccattgtcaaacacttccaaagcgttatttcaaag
gaatccaaacagcagctccaaagcaaggaaggccgactgccggatatggttgttgcctgt
atcggtggcggtagtaatgccattggcagctttgcagactatatcgatgacccatccgtt
aaattagtcggtgttgaaggtgccggcaaaggtgtcgatactgatcggactgctgctact
atcgaacggggaacggttggtattttccacggcatgaaatcactgttcatgcaaaacgat
gacggtcaaattgatccggtttactcaatttcagccggtttggattacccgggtgtcggt
ccggaacacgcggcgcttgcccaggaaggccgggcgcaatacgttgggattaccgatgat
gaagctgttcaggcattcgaatacattgcccgggaagaaggcattgtagccgcaattgaa
agttgccatgccgttgcctacgttgaaaaaattgcgccaaagatgtccaaagatcaaatt
attgtctgcaccctctccgggcgtggtgacaaggatgtcgcaagcatcgccaaatataaa
ggagtggacattgatgagtaa

DBGET integrated database retrieval system