KEGG   Lactobacillus helveticus R0052: R0052_11180Help
Entry
R0052_11180       CDS       T02217                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R0052_11180 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R0052_11180 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R0052_11180 (trpA)
Enzymes [BR:lhr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     R0052_11180 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1978391..1979185
Genome map
AA seq 264 aa AA seqDB search
MSNLSEIFKNHKAFIPFVVADDPDFDTTVKNVVALANAGADIVELGIPFSDPVADGPVIQ
AADLRAFDAKVRTKTVFEIVEAARKQTDVPIVFLTYLNIVFKYGYDAFLKRCADLDVSGL
VIPDLPYESRDEIVPIAEKYNIDIIPLITLTSGHRIEKIAKSASGFIYVVSSLGITGERN
EFFNGLKDLVANIKQYTDVPTAIGFGVHTPEQARTMAEIADGVIIGSAIVDIVAKEKQQA
PAAVGKFTKQIREAVNSVKQVPVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttatcagaaattttcaaaaatcataaagcttttattccgttcgtagtcgct
gatgacccggactttgatacaactgtaaaaaatgtagttgcgctcgcaaacgccggtgcc
gacattgttgaattaggaattcccttttccgatccagtcgccgatggtccggttattcaa
gcagccgacctgcgagcctttgacgcaaaggtccgcaccaagactgtctttgagattgtc
gaagcagccagaaaacaaaccgacgttccaatcgtctttctaacttacttaaacatcgtc
ttcaaatatggctatgacgccttcttgaagcgttgtgccgacctagacgtgtccgggctg
gtaattcccgatttaccatatgaaagtcgtgatgagattgtgccgatcgccgagaagtac
aacatcgacattatcccactgattacgctgacgtccggacatcggatagaaaagatcgct
aagagtgcttccggcttcatctacgtagtctcctcactgggaattaccggtgaacgaaac
gaattcttcaacggcttaaaagacctggttgccaatatcaagcagtatactgatgttccg
actgccattgggtttggtgttcatacgcccgaacaggcgcgaacaatggccgaaatcgct
gacggcgtgattattggtagtgccatcgttgacattgtcgccaaagaaaaacaacaggcg
ccagctgctgttgggaaatttacaaagcagattcgcgaagctgttaatagcgttaagcag
gtaccggttaaatag

DBGET integrated database retrieval system