KEGG   Lactobacillus helveticus R0052: R0052_11180Help
Entry
R0052_11180       CDS       T02217                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lhr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lhr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lhr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1978391..1979185
Genome map
AA seq 264 aa AA seqDB search
MSNLSEIFKNHKAFIPFVVADDPDFDTTVKNVVALANAGADIVELGIPFSDPVADGPVIQ
AADLRAFDAKVRTKTVFEIVEAARKQTDVPIVFLTYLNIVFKYGYDAFLKRCADLDVSGL
VIPDLPYESRDEIVPIAEKYNIDIIPLITLTSGHRIEKIAKSASGFIYVVSSLGITGERN
EFFNGLKDLVANIKQYTDVPTAIGFGVHTPEQARTMAEIADGVIIGSAIVDIVAKEKQQA
PAAVGKFTKQIREAVNSVKQVPVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttatcagaaattttcaaaaatcataaagcttttattccgttcgtagtcgct
gatgacccggactttgatacaactgtaaaaaatgtagttgcgctcgcaaacgccggtgcc
gacattgttgaattaggaattcccttttccgatccagtcgccgatggtccggttattcaa
gcagccgacctgcgagcctttgacgcaaaggtccgcaccaagactgtctttgagattgtc
gaagcagccagaaaacaaaccgacgttccaatcgtctttctaacttacttaaacatcgtc
ttcaaatatggctatgacgccttcttgaagcgttgtgccgacctagacgtgtccgggctg
gtaattcccgatttaccatatgaaagtcgtgatgagattgtgccgatcgccgagaagtac
aacatcgacattatcccactgattacgctgacgtccggacatcggatagaaaagatcgct
aagagtgcttccggcttcatctacgtagtctcctcactgggaattaccggtgaacgaaac
gaattcttcaacggcttaaaagacctggttgccaatatcaagcagtatactgatgttccg
actgccattgggtttggtgttcatacgcccgaacaggcgcgaacaatggccgaaatcgct
gacggcgtgattattggtagtgccatcgttgacattgtcgccaaagaaaaacaacaggcg
ccagctgctgttgggaaatttacaaagcagattcgcgaagctgttaatagcgttaagcag
gtaccggttaaatag

DBGET integrated database retrieval system