KEGG   Lactobacillus helveticus CNRZ32: lhe_0602Help
Entry
lhe_0602          CDS       T02744                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lhv  Lactobacillus helveticus CNRZ32
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lhv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lhe_0602
Enzymes [BR:lhv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     lhe_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(680823..681749)
Genome map
AA seq 308 aa AA seqDB search
MKKIVVIGSSNVDTTLHVKDFPKPGETINATEITSAGGGKGANQAIAAAKSGAETYFINR
VGEDSEGGYITHQLKSYGVDTTYVQTTMGSKTGHAYITLKEAGQNDIIIDHGANYELTVE
DIQAASDLFKDVDCVIAQFETPLEVTIEAFKLAKKAGKITILNPAPAIDKIPKELLQYTD
IITPNETESDKITGIQIKDNSTLATNAEKLHLLGVKNVVITYGDKGAYISSADIETLVPA
YKVEATDTTGAGDTFIGYLASNLKPDLSNFEAAAKIANRASSIAVQRLGAQPSIPTAKEV
EEAMEDNE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgtagttattggttcaagcaatgtagatactacattgcacgtaaaggac
tttccaaaaccaggtgaaacgattaacgccacagaaataacttctgctggtggtggtaaa
ggtgcaaaccaagccatcgccgcagctaaaagtggtgcggagacttattttattaatcgt
gtcggtgaagacagcgaaggtggttatatcacccatcaattgaagagttatggtgttgac
actacctatgttcaaaccacgatgggaagcaagactggtcatgcttatattacattaaaa
gaagcaggacaaaatgatattattatcgatcatggtgctaactatgaattgaccgttgaa
gacattcaggctgctagtgatttgtttaaagatgttgactgtgttattgcccaattcgaa
acgccacttgaagtaacaattgaggctttcaagttagctaaaaaggcaggaaaaatcaca
attttaaatcctgctcctgctattgataagattccaaaagagttgttgcaatacacagat
attattacgccaaatgaaactgaaagtgacaaaattacgggcatccaaataaaggacaat
tcaactttggcaacgaatgctgaaaagttgcatcttcttggcgttaaaaacgtagtaatt
acatacggtgataaaggtgcatatatttcatctgcagatattgaaaccttagttccagct
tataaagttgaagcaactgataccactggtgcaggcgatacctttattggttatttagca
agcaacttaaagccagacttatctaattttgaagcagctgccaagattgctaatcgtgcc
tcatcaattgcagttcaacgcttgggtgctcaaccttcaattcctactgccaaggaagta
gaagaagccatggaggataatgaataa

DBGET integrated database retrieval system