KEGG   Lactobacillus helveticus CNRZ32: lhe_0771Help
Entry
lhe_0771          CDS       T02744                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lhv  Lactobacillus helveticus CNRZ32
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lhv00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881629..882228
Genome map
AA seq 199 aa AA seqDB search
MSQLFFRYGAMSSGKTIEILKVAHNYEAQGRKIALMTSGLDNRSGVGTVASRIGLHRKAI
PITADMNLYTYIEKMNSHDLADGKGKLACVLIDEAQFLKRHHVLECAKIVDEFNIPVMAF
GLKNDFQNHLFEGSENLLIFADKIEEMKTICHYCGHKATMNLRVNNGKPVYEGEQVQIGG
DESYYPVCRYHYFHPGIQR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaattattttttcgttatggtgcaatgagtagtggtaaaacaatagaaattcta
aaagtggctcacaattatgaggcacaagggcgaaaaattgctttaatgacaagtggactt
gataatcgtagtggtgttggtacggttgcttctagaattggacttcatcgtaaggcaatt
ccaattactgcggatatgaatttatatacatacattgaaaaaatgaatagccatgattta
gctgatggaaaaggaaaattggcttgtgtcttaattgatgaagcacaatttttgaaaaga
catcatgttttagaatgtgccaaaattgtagatgaatttaatattccagtgatggcattt
ggcttaaaaaatgattttcagaatcatttatttgaaggcagtgaaaatttattgattttt
gctgataaaatagaagagatgaaaactatttgtcattattgtggtcataaagcaacgatg
aatttaagggttaataatggcaaacctgtatatgaaggtgaacaagtgcaaattggtggc
gatgaaagttactatccagtttgtcgttatcattattttcacccaggtattcagagatag

DBGET integrated database retrieval system