KEGG   Leptospira interrogans serovar Copenhageni: LIC10426Help
Entry
LIC10426          CDS       T00166                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lic00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:488013..488906
Genome map
AA seq 297 aa AA seqDB search
MISPAKINLGLEIPFKRLDGFHEIRSVFLKISWGDDIEIEPASNGVFELFSNNEIILEKR
KLYDQVSERGDIKNNILYKTFIKARSLFPELPGVKIHLTKRISPAGGLGGGSTNAASLLN
FLFSWCPFFTSDEMFVLAAEIGSDVPFFLGEGHAFVTGKGEILEEIEVHHGQGILALTPQ
VMNTSEMYSLLKKPLQESASQKNGNTLSKNLISILKNGDWSSLQGRLWNDFEPVAFQLHP
ELGVLKDKFLEFGSSYCSLTGSGSSMYGLVQGLEIQEELLQRLRQEFSNLTFVRFNF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgatttctcctgctaagattaatcttggattggaaattccatttaaacgtcttgatggg
tttcacgaaattcgaagtgtatttttaaaaatttcttggggtgatgatatagaaatagaa
cctgcgtctaacggggtttttgaacttttttccaataacgaaattatattagaaaaacgt
aaactatatgatcaggtttccgaaagaggtgatattaaaaataatattctttataaaact
tttataaaggcgagatctctttttccagaacttccgggtgtgaaaattcatcttacaaaa
cggatttctccggcaggtggtcttggaggaggaagtacaaacgcggcttctttattaaac
tttcttttttcttggtgtcctttttttacttccgatgaaatgttcgttcttgctgctgaa
attggttccgatgttcctttttttttaggagaaggacatgccttcgttactgggaaggga
gaaattttagaagaaatagaagttcatcatggacaaggaattcttgcgttaactccgcag
gtgatgaatacatcggaaatgtactccttattgaaaaaacctttacaagagagcgcttct
cagaaaaatggaaacactctgtcgaaaaatctaatttctatactaaaaaatggagattgg
agctctcttcagggtaggctctggaatgattttgagccggttgccttccaacttcatccg
gaattgggagttctcaaggacaaatttctggagtttggatccagttattgttctttgacc
ggttcgggttcgagtatgtacgggctggtgcagggtctcgagatccaagaagaactgtta
caaaggcttaggcaggaattctcaaatctcacattcgtacgatttaacttttag

DBGET integrated database retrieval system