KEGG   Leptospira interrogans serovar Copenhageni: LIC10629Help
Entry
LIC10629          CDS       T00166                                 

Gene name
glpK2
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LIC10629 (glpK2)
Enzymes [BR:lic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LIC10629 (glpK2)
Exosome [BR:lic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIC10629 (glpK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(766917..768464)
Genome map
AA seq 515 aa AA seqDB search
MANSQGKYVLSIDSGGSGIRAFLLDRKGNIVERQYEKTPPNIPEAGALEHDPEILWKALL
SLLKKIQKNQQIVKEIIALGICNQRGSFLLWEKSTGKPLTPLISWADVRSHKIAEAMNRN
LIWTIIRVVSTFVGRLTNHPMMIATSMLRFTTDHATCRLKWILDKNPDLKQRCKKGEVLF
GTLDTWFIYKLTGQKQHLTDSSNAVATGMFNPFQLIWNQPILSIFGIPSNLFPEVKDSNG
DFGHTLPEYLGGHSIPIRASIGDQMAALFGHCCFERGEVKISQGSGAFVDINIGPKAKLS
KRGLFPMIAWRIDGNTTYMLEGYVATAGTLIDWLGQGIGLSDTPKVLNELAAQSEDTEGV
VFIPTPTGARFPYFNPRAKASVIGLSLASHRRHVARAVLEGISLSLYEILEGIQRDTKVE
IKDIKVDGGVSQSDILLQCLSDFSNVRVNRSPEPDMTATGTAYLAGLAVGFWKNLDELKN
LQKGYKSFEPKMNPTKRVQKIQRWKKAVTATLSIE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctaattcacagggcaaatacgtcctttccatcgacagtgggggaagcggaattcgt
gcgtttttattagatcgaaaaggtaatatagtcgaaaggcaatatgaaaaaactcctcct
aatattcccgaagcaggtgctttagaacacgatccagaaatcctatggaaggcccttctt
tctcttttaaaaaagatccaaaaaaatcagcaaattgtaaaagaaattatcgcattagga
atttgtaatcaacgcggctcctttcttctctgggaaaaatccacaggaaagccattaact
cctttgatcagttgggcggacgttcgttctcataaaattgcagaagcgatgaatcgaaat
ctaatctggacaatcatccgtgttgtatctacgtttgtaggaagattgacaaaccatcca
atgatgatcgccacttccatgctccgatttacgacagatcacgcaacttgtagattaaaa
tggattttagacaaaaatccagatctaaaacagagatgcaaaaaaggtgaagttcttttt
ggtacgttagatacttggttcatttataaacttaccggtcaaaaacaacatctcaccgat
tcgtcaaatgcagttgctacgggaatgtttaatccttttcaattgatctggaaccaaccg
attctttcaatattcggaattccttctaatttatttccggaagtaaaagatagcaacgga
gacttcggtcatactttgccagaatatttaggaggacattcgattccaatcagagcttcg
attggagatcaaatggcggctctatttgggcattgttgttttgaaaggggcgaagtaaaa
atttctcaaggttccggggcatttgtggatattaacatagggcccaaagcaaaactttcc
aaacgcggtctttttccaatgatcgcttggagaatagacggcaataccacatatatgtta
gaaggttatgttgcaaccgctggaaccctcatagattggttaggacaaggaatcggactt
tccgacactcctaaagttttgaacgaacttgcggcccaatcggaagatacagaaggagtc
gtttttattccaactcctacgggagcccgttttccttatttcaatcctcgtgccaaggca
tccgtgatcgggctttctctagcatctcatagaagacacgttgcaagagccgtcctagaa
ggaatttctctcagtctctatgaaattttagaaggaattcaacgagatacaaaagttgaa
atcaaagacattaaagtggacggcggtgtatctcagtctgatattcttcttcaatgtctt
tcagatttttcgaatgtaagagtaaatcgttctcccgaaccagatatgactgcaacagga
acggcgtatcttgctggtttggcagttggcttttggaaaaatttagatgaattgaagaat
ttacaaaaaggttataaatctttcgaaccgaagatgaacccaacaaaaagggttcaaaaa
attcaacgttggaaaaaagcagttaccgcaactctttccatcgaatga

DBGET integrated database retrieval system