KEGG   Leptospira interrogans serovar Copenhageni: LIC10809Help
Entry
LIC10809          CDS       T00166                                 

Gene name
adh
Definition
zinc binding dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LIC10809 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIC10809 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    LIC10809 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LIC10809 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LIC10809 (adh)
   00626 Naphthalene degradation
    LIC10809 (adh)
Enzymes [BR:lic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LIC10809 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:980016..981062
Genome map
AA seq 348 aa AA seqDB search
MGIMGMKAAVLESGKKILEIRDVSVPQLRAEQVKVRIKACGICGSDVHLVVHGTLKCKHF
PRVPGHESSGIIEEVGENVRRFRKGDRVVIAAGTSCGVCSYCKEGKENLCKDLGVFGFDR
DGSFAEFNIVEERYLYSLPDEIPFDQGAILADAVSTPYHAIRYRGNIQESDTVAIFGCGG
LGIHAVAIARAMTKGKVIALDVDSGALENATKYGADEVVNLKEVRNSGKVLKEVSKGVDL
LADFSGYMSNVEDSIRAMNPGGRIVLVGIGRQPLKFQIPFILIEKMISVSGSYGSDRRAI
PELIELYLKGKINLSHSITSHHPLEELNECLEALDQRKGNPIRFIVEP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttggggataatgggaatgaaagctgcggttttagaatccggtaaaaaaattttagagatc
agagatgtttccgttccacaacttagggctgaacaagtaaaggtaagaattaaggcttgt
ggtatttgtggttcagacgtacatctcgtggttcatggaactctcaaatgtaaacatttt
cccagagttccaggacatgagtcatcgggaattatcgaagaagtaggcgagaacgttaga
cgattccgtaaaggagatcgagtggtcatcgcggccggaacttcatgtggagtttgttct
tattgtaaagaaggaaaagaaaatctatgtaaagatttaggtgtgtttggttttgatcga
gatggaagttttgcagaatttaatatagtagaagaacgttatttgtattctcttccagat
gagattccatttgatcaaggagcgattcttgcagatgctgtatctactccttatcacgct
attcgttacagagggaatattcaggaaagtgatacagtagctatttttggttgtgggggg
cttggaatccatgcggtggcgattgcaagggcgatgacaaaaggtaaggtgattgcattg
gatgtggattcgggagctttagaaaacgctaccaaatatggagctgatgaagtggttaac
ttgaaagaagttcgaaattcgggcaaggttctaaaggaagtatcgaaaggtgtagatcta
cttgccgacttttcgggttatatgtctaacgtagaagattcaatacgagcgatgaacccg
ggaggtagaattgtacttgtaggtattggaagacagcccttgaaatttcagattcctttt
atattaattgaaaaaatgatttctgtttctggttcttatggatccgatcgtagagcgatt
cctgaattgattgaactttatctaaaaggaaaaatcaatctttctcattcgattacttct
catcatccattagaagaattgaatgaatgccttgaggccttggatcagagaaaaggaaat
ccgattcggtttattgttgaaccttaa

DBGET integrated database retrieval system