KEGG   Leptospira interrogans serovar Copenhageni: LIC10859Help
Entry
LIC10859          CDS       T00166                                 

Gene name
trpB1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lic01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lic00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lic00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1035553..1036746
Genome map
AA seq 397 aa AA seqDB search
MGKENQQGYFGEFGGRYSPEILHDALVELETTYKKLKKNKHFKKELEYYRKNYIGRPSPL
TYAERLSKVWGGAKIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQHGVA
TATVGAMFQMETVVYMGEEDLRRQELNAIRMRMLGAKVVGVSSGTATLKDATSEAMRDWA
LNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVNDKLPNAVIACVGGGSNAI
GMFYGFIQDKKVKLFGVEAGGYSSDPGSHSATIQFGRTGFLHGTKTLVIQDDFGQIVPAH
SVSAGLDYPGVGPEHAYFHKSGRVEYVNVDDEGALDAFIEVCRIEGIIPALETAHAFRYA
KDLARTMSKKENILICLSGRGDKDVAEVSRLRKGEFI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaaaatcaacaaggctactttggagaatttggcggtcgttattctcctgaa
attcttcacgatgctctcgtagaacttgaaacgacttataaaaagctcaagaaaaacaaa
cactttaaaaaagaactagaatactatcgtaaaaattatatcggtcgtccttctcctctt
acttatgcggaacgtctttctaaggtttggggcggcgctaaaatctggctcaaacgcgaa
gatttaaatcatactggagcgcataagatcaataatacgatcggtcaggttttgattgct
aaggctatgggtaaaactagaatcattgcggaaaccggcgccggtcaacacggtgttgca
actgcaaccgtaggcgctatgttccagatggaaaccgtagtttatatgggtgaagaagac
ttaagacgtcaggaactcaatgcgatccggatgagaatgttgggcgctaaagtcgtaggt
gtttccagtggtaccgctactctcaaagacgcgactagcgaagcgatgagagactgggca
ttaaatgtttctaatactcattatattgtgggttcttctatcggtccacatccgtttcct
acgattgtcagagacttccaatctgtgatcggtattgaatctagaaaacagtttaaaaaa
gtaaacgataaacttccaaacgccgtgattgcttgtgtcggcggcggctcgaacgcgatc
ggtatgttttacggttttattcaggataaaaaagttaaactctttggtgtagaagccggt
ggttattcttccgatcctggttctcattctgctaccattcaatttggtagaaccggtttt
ttacacggtactaaaactttagtgattcaagacgattttggacagatcgttcccgctcat
tccgtttctgctggattggattatcctggtgttggtccggaacacgcttactttcacaaa
agtggtagagttgaatacgttaacgtagacgacgagggagcgttagacgcgtttattgaa
gtttgtagaattgaaggtattattcccgctttggaaactgcgcatgcgttccgttatgcg
aaagatctggcaagaactatgagcaaaaaagagaatattctgatttgtctttccggtaga
ggtgacaaggacgtggcagaggtttctagacttagaaaaggagaatttatttga

DBGET integrated database retrieval system