KEGG   Leptospira interrogans serovar Copenhageni: LIC10860Help
Entry
LIC10860          CDS       T00166                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIC10860 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LIC10860 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIC10860 (trpA)
Enzymes [BR:lic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LIC10860 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1036743..1037537
Genome map
AA seq 264 aa AA seqDB search
MNSISSVFSSEQSVFIPYISLGDPDYDSCVIWADALIRGGAGILELGIPFTDPVADGPVI
QKAFKRSLAHPFSMDKILEVTSEIHKLHPQIPLVYLTYFNPLFSMGLESFTERAKNSGIQ
GLIIPDLPFDTPEAEEFFSQLERKRIDFIHLVTPATTEDRIRSMKSLASGFIYYVTSYGV
TGERGSIASGLEDRIRMVRKIVGLPVCAGFGISTSDQSKVISTYADGVIIGSAVQRIIEE
NGSDRNNCADKLLAYASEIRASMR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaactccatttcttccgttttttcttcggagcaaagtgtttttattccttatatttct
ttgggtgatccggactatgattcctgcgttatttgggcggatgctttgattcgaggtggt
gccggcattttagaattgggaattccttttactgatccggttgccgatggtccagtgatt
caaaaagcttttaaacgttctttggctcatcctttttccatggataaaattttagaagtt
acttcggaaattcataaacttcatcctcagattcctctcgtatatcttacttattttaat
cctttgttctctatgggtttggaatcttttacggaaagagctaaaaattctggtatccaa
ggtttgatcattccggaccttccgtttgataccccggaggcggaagaatttttttctcaa
ctcgaaagaaagagaatcgattttatccatcttgtgactcctgctactacggaagacaga
attcgttcgatgaaatctcttgcgtccggttttatctattacgtgacttcttacggcgtt
accggggaaagaggttcgattgcgtctggtttggaagatagaattcgaatggtgcgtaag
attgtcggtcttccagtttgtgctggttttgggatttccacttcagatcaatctaaggtt
atttcgacttatgcagatggagtgatcatcggttctgccgtgcaaagaatcattgaagaa
aacggatctgatcgtaataactgtgcggataaacttctggcctacgcttctgagattcgt
gcttcgatgagatag

DBGET integrated database retrieval system