KEGG   Leptospira interrogans serovar Copenhageni: LIC11148Help
Entry
LIC11148          CDS       T00166                                 

Gene name
ruvA
Definition
DNA helicase subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lic03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1416118..1416756
Genome map
AA seq 212 aa AA seqDB search
MISGLKGILRKLEVGFVHIETGGITYEVTISFKTYLELKNLPLLKEVQLQIFHSINERGQ
KLFGFLTEQDKEFFKVMKGLQGIGELTALKILSFFSAEDLYRIVQSGEVKELEKIPKVKG
KTSEKIFFEVKQNLKKLELFLSGSSKESSVILTSLLQSPEEMAFSKKRETVILGLVQLGF
EEKTASKEVDKVLKIFSSNDPGEIIREILKSL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaggtttaaaaggaattctcagaaaattagaagtaggatttgtacatatagaa
accggtggaatcacttatgaagtgacgatttcttttaaaacctatttagaattaaaaaat
cttcctttattgaaggaagttcaattacaaatttttcactctataaatgaaagaggacaa
aaattatttggttttttgacagaacaagacaaagagtttttcaaagttatgaaaggtctt
caaggaataggagaattgaccgcactcaaaattttatcctttttttcggcggaagatttg
tatcggatcgttcaatctggagaagtcaaagaactggaaaaaattccaaaggttaaaggt
aaaacttcggaaaaaattttttttgaggtaaaacaaaatcttaaaaaactggaattattc
ttgtccggctcttcgaaagagtcttcggtaattttaacttctttgcttcagtccccagaa
gaaatggcattttccaagaagagagaaacagtgatccttggtttagttcaattaggattt
gaagaaaaaacagcctctaaagaggtggataaggttttaaaaattttttcgtcaaatgac
cctggagaaatcatccgtgaaattttaaaaagtctttga

DBGET integrated database retrieval system