KEGG   Leptospira interrogans serovar Copenhageni: LIC11148Help
Entry
LIC11148          CDS       T00166                                 

Gene name
ruvA
Definition
DNA helicase subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LIC11148 (ruvA)
Enzymes [BR:lic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LIC11148 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1416118..1416756
Genome map
AA seq 212 aa AA seqDB search
MISGLKGILRKLEVGFVHIETGGITYEVTISFKTYLELKNLPLLKEVQLQIFHSINERGQ
KLFGFLTEQDKEFFKVMKGLQGIGELTALKILSFFSAEDLYRIVQSGEVKELEKIPKVKG
KTSEKIFFEVKQNLKKLELFLSGSSKESSVILTSLLQSPEEMAFSKKRETVILGLVQLGF
EEKTASKEVDKVLKIFSSNDPGEIIREILKSL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaggtttaaaaggaattctcagaaaattagaagtaggatttgtacatatagaa
accggtggaatcacttatgaagtgacgatttcttttaaaacctatttagaattaaaaaat
cttcctttattgaaggaagttcaattacaaatttttcactctataaatgaaagaggacaa
aaattatttggttttttgacagaacaagacaaagagtttttcaaagttatgaaaggtctt
caaggaataggagaattgaccgcactcaaaattttatcctttttttcggcggaagatttg
tatcggatcgttcaatctggagaagtcaaagaactggaaaaaattccaaaggttaaaggt
aaaacttcggaaaaaattttttttgaggtaaaacaaaatcttaaaaaactggaattattc
ttgtccggctcttcgaaagagtcttcggtaattttaacttctttgcttcagtccccagaa
gaaatggcattttccaagaagagagaaacagtgatccttggtttagttcaattaggattt
gaagaaaaaacagcctctaaagaggtggataaggttttaaaaattttttcgtcaaatgac
cctggagaaatcatccgtgaaattttaaaaagtctttga

DBGET integrated database retrieval system