KEGG   Leptospira interrogans serovar Copenhageni: LIC11414Help
Entry
LIC11414          CDS       T00166                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LIC11414 (tesA)
Enzymes [BR:lic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LIC11414 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LIC11414 (tesA)
Lipid biosynthesis proteins [BR:lic01004]
 Fatty acid synthase
  Component type
   LIC11414 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1741195..1741827
Genome map
AA seq 210 aa AA seqDB search
MFCFKIMIFIFSCFFFTSIHSDSKTVRILFFGDSLTAGFGLNSPEEAFPALLEKELSKKG
IVSQTINAGVSGDTSSGGLARLNWAMSSDFDLFVLELGANDSMRGISPDQTEKNLKEIIS
KVRKKNSKAKILLLGMKTFPNLGKEYRKKFEAVFPKIAKEENLILVPFFLDGVAGIKNLN
QKDGIHPTAEGHRILAKNLIPFFQKILKSK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtttcaagataatgatttttattttcagttgtttcttttttacttccattcat
tcagattctaaaacggttcgaattctatttttcggagatagtctcactgcaggttttggt
cttaattctcccgaggaggcatttcctgcacttttagaaaaagaactttctaaaaaagga
attgtttctcaaacgatcaacgcgggtgtaagcggggatacaagttctggaggacttgct
cgtttgaactgggcgatgtcatccgattttgatctgtttgttttggagttaggggccaac
gattccatgagaggaatttctcccgatcaaaccgaaaaaaatttaaaagagatcatctct
aaagtgagaaagaaaaattcgaaagcaaagattcttcttttgggtatgaagacatttcca
aatttaggaaaagaatatagaaaaaaattcgaagccgtgtttcctaaaattgcaaaagaa
gaaaatttaattttagttcctttctttttagatggggttgcaggaatcaaaaatttaaat
cagaaagatggaattcatccgactgcagaaggacatcgtattcttgctaaaaatctaatt
ccattttttcaaaaaattttgaagagtaaatga

DBGET integrated database retrieval system