KEGG   Leptospira interrogans serovar Copenhageni: LIC11586Help
Entry
LIC11586          CDS       T00166                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LIC11586
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIC11586
  Lipid metabolism
   00071 Fatty acid degradation
    LIC11586
  Amino acid metabolism
   00350 Tyrosine metabolism
    LIC11586
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LIC11586
   00626 Naphthalene degradation
    LIC11586
Enzymes [BR:lic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LIC11586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1944091..1945149
Genome map
AA seq 352 aa AA seqDB search
MNRVLTYLSPGELDWREMPRPILSHPEDAIVRPVASSTCDLDIMIIQGRTPFKGPFDIGH
ECIGEIIETGEGVRRFYPGQLVVVSWHISCGQCHRCRKGLMNTCASYPQGAMFGMSIGGK
WGGFFSDFIRVPNADISLFVLPPGINPSYVASLSDNIPFGYELTVPHLTRNCGVDVLIMG
GTGSIGLFAAAYAKAGGAGSVDYVDTNKMRLGIAEKIGVNPIESPPKQRIGRRPGKYPIT
VDTSGSSEGLLCAIRSTEPEGYCSSIGGHFGDIAFPMLEMYAKGIHFYTGRGLGRINFEA
ATDFIISGKVKPELIVTEERPFDEAAEVLRDPSMKPVLVRQTMLSKAYQPKV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgagttctcacatatctttcacccggagagttggattggcgtgaaatgcccagg
cctatactatcacatccggaagatgcaattgttcgtcccgtagcgtcatcaacttgtgat
ttagatataatgatcatccaaggaagaactccttttaaaggtccttttgatattggtcac
gaatgtattggtgaaattatagagactggcgaaggagttcgtcgtttttaccctgggcag
ttggtcgttgtgagttggcatatttcttgcggtcagtgccacaggtgtcgtaagggactg
atgaatacctgtgcttcttatcctcaaggggcaatgtttggtatgtccataggcggcaaa
tggggtggcttcttttctgattttattcgtgtgccaaacgcggatatatccctatttgtt
ttgccaccgggaattaatccttcatatgttgcaagtttaagtgacaacattcctttcggt
tacgaattaacggtaccacatctcactcgtaattgcggagtagacgtattgattatgggt
ggtacgggttccatcggactatttgcggctgcttatgcaaaggctggtggggctgggtcc
gtcgactatgttgacacaaacaaaatgcggttaggtatcgctgaaaaaataggagtaaat
ccgatcgaaagtcctccaaaacaacggattggcaggcgccctggaaaatacccaatcact
gtggatacaagcggttcatccgaaggtcttttatgtgcaattcgttctacggaacccgaa
ggttattgttctagtataggtggtcactttggagacattgcgtttccgatgttagagatg
tatgccaaagggatacacttttatacgggacgtggtttaggaagaatcaactttgaagcg
gctacggattttattataagtgggaaagtcaaaccggaactgatcgttacagaagaaaga
ccgtttgatgaagcggctgaagttttacgggatccttctatgaaaccggtattagttcga
cagaccatgctttctaaggcttaccaacccaaggtataa

DBGET integrated database retrieval system