KEGG   Leptospira interrogans serovar Copenhageni: LIC12094Help
Entry
LIC12094          CDS       T00166                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIC12094 (tpiA)
   01230 Biosynthesis of amino acids
    LIC12094 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIC12094 (tpiA)
   00051 Fructose and mannose metabolism
    LIC12094 (tpiA)
   00562 Inositol phosphate metabolism
    LIC12094 (tpiA)
Enzymes [BR:lic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LIC12094 (tpiA)
Exosome [BR:lic04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LIC12094 (tpiA)
  Exosomal proteins of bladder cancer cells
   LIC12094 (tpiA)
  Exosomal proteins of melanoma cells
   LIC12094 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2533875..2534627
Genome map
AA seq 250 aa AA seqDB search
MRKTIIAGNWKMNLSLKEAVFLAHSIREKIPSISKDKVSMVFPSTLHLENVSKILEGSSV
IVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKN
EFTVLYCVGETLSERESGKTLEVLSSQIREGLKGIDSVFFSNLILAYEPVWAIGTGKVAT
PSQAQEVHSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGAS
QKISSFAGLF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagacaattattgcaggaaactggaaaatgaatttatctcttaaagaagccgtt
ttcctagcacattcgatccgagaaaaaattccatccatttctaaagataaagtctcgatg
gtatttccttctactcttcatcttgaaaacgtttccaaaatattagaaggtagcagtgta
attgttggagcccaaaactgttatcactccggacttgcagcttttaccggcgaaacctct
cccgatcaactgaaagaaattggtgttaaagttgtaatggtcggtcattcggaacgtcgt
caatttttaggagagtctaactttttttgtaacgataaaatccgttttcttttaaagaac
gaatttacagtcctttattgtgttggagaaactctctccgaaagagaatccggtaaaaca
ttggaagtactgtcttctcaaattagagaaggtttaaaaggaattgatagcgtatttttt
tccaatttaattctggcttatgaaccagtttgggccattggaaccggaaaagttgccacc
ccctctcaagcccaagaagtacattcttttattcgtaaagaaatttctggtctttttgta
ggcgcctcttctatttcagaatccatttctattctctacggtggttctgtaaaaccagac
aatattcaagatctattaaaagaaaaagatatagatgggggtttagttggaggagccagc
caaaaaatcagttccttcgctggacttttctaa

DBGET integrated database retrieval system