KEGG   Leptospira interrogans serovar Copenhageni: LIC12312Help
Entry
LIC12312          CDS       T00166                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIC12312 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIC12312 (glcK)
   00052 Galactose metabolism
    LIC12312 (glcK)
   00500 Starch and sucrose metabolism
    LIC12312 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LIC12312 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LIC12312 (glcK)
   00524 Butirosin and neomycin biosynthesis
    LIC12312 (glcK)
Enzymes [BR:lic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LIC12312 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2787547..2788443
Genome map
AA seq 298 aa AA seqDB search
MKSFLGIDIGAGSIKASLIDSNGNVLKSSFRKTGAETNEKQFLDSICDIVSEMKNSSLTA
VGIGSPGPIDSENGILIESANLPLLKNVTLVSHLKEKFSIPVYYNNDANLAALGEYHFGL
GKGSPNLVILTLGTGLGGGWVYQGKLFNGYKGSGMEAGHVTYLPNGSLCGCGQRGCTEAY
FSASGFLNRYKEKTGEVLDSAEEFFEKTRKGDKTASILLNEGIDALAQLCRNLIHTINPE
KIVFTGGLVKSWDLFGDSLQNRIRELIFPIFRTYTQILPGGNVSGTLGAAALCMENLE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctttcttggaatcgatataggtgcaggaagtatcaaagcaagtctcatcgat
tccaacggaaacgtactgaaaagttctttccgtaaaaccggcgcggaaacaaacgaaaaa
caattcctagattctatttgtgacatcgtatcagaaatgaaaaactcttctttgacggcg
gtgggcataggaagcccagggccaatcgattctgaaaacggaattttgatcgagtccgct
aatcttcctcttttaaaaaatgtgacgttagtctctcatttaaaagaaaaattttctatt
ccagtatattataataatgatgcaaaccttgctgcgttgggagaataccatttcggttta
ggaaaaggatcgcctaatttggtaattttaaccttaggaaccggattaggaggtggttgg
gtatatcaaggaaaactttttaacggttacaaaggaagtggaatggaagcgggacacgtt
acgtatcttccaaacggctctctatgcggttgtggtcaaagaggttgcaccgaagcttat
tttagcgccagcggatttttaaatcgatataaagaaaagaccggagaagttttagattcc
gcagaagaattctttgaaaaaactagaaaaggagataaaaccgcatcgattttgttaaac
gaaggtattgacgcgcttgcacaactttgtagaaatctaattcatacaatcaacccggag
aaaattgtttttacaggaggacttgtaaagtcctgggatttattcggtgattccctacaa
aatagaatccgggaactgatctttccaattttcagaacttatactcaaatcctccccgga
ggaaacgtatccggcacattaggcgctgcggcgctttgtatggagaatttagaatga

DBGET integrated database retrieval system