KEGG   Leptospira interrogans serovar Copenhageni: LIC12476Help
Entry
LIC12476          CDS       T00166                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIC12476 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LIC12476 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    LIC12476 (sucB)
Enzymes [BR:lic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LIC12476 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2999273..3000538)
Genome map
AA seq 421 aa AA seqDB search
MSVEIKVPEMGESITEATIANWVKKEGESVKQDEILLELETDKATMEVPAPSSGVLQKIH
KKAGETVKVKEIIGLIDSSATASSPSPSASAPTNSAQTTQTSGNGTINETLPPAVRKLIE
DNGLNPASITGSGKNGQITKEDVLKAIETKATSSVSNASVNVGTPAAVKATLTLPEIPKA
VPAARRTDLPRENVVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDKF
KEAHNVSLGFMSFFTKAAIHALKTIPAINAEIRGSDIVYKNYYDIGVAVGGPKGLVVPVV
RDADLLSFAGVEQEIIRLANRVKDGKIELAEMEGGTFTISNGGIYGSMMSTPILNPPQSG
ILGLHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPSRLLLE
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaattaaggtccccgaaatgggggaatccattacggaagctacgattgca
aactgggtaaagaaagaaggagaatctgtaaaacaagacgagatcttgttagaactggaa
accgataaggcgaccatggaagttccggctccttcttcgggtgttcttcagaaaattcat
aaaaaggctggagaaaccgtaaaagtaaaggagatcatcggactgattgactcttcagca
actgcttcttctccttctccttccgcttctgctccaacaaattcagcacaaacgactcaa
acatcaggaaacggaaccataaacgaaactcttccgcctgcggtccgtaagttgatcgaa
gacaacggactcaatccggcatcgattactggttccggtaaaaacggacaaatcacaaaa
gaagacgtattaaaagcaattgaaacaaaagcgacgtcgtcagtttcaaacgcttccgta
aatgtaggaactccagcggctgtcaaagcgacgctgactttacctgaaattccgaaagcg
gttccggctgcgagaagaacggatctaccaagagaaaacgtagttcctatgactcgactt
cgtaaggtaattgcagaaagacttgtatcggcacaacacaacgctgcaattctgaccacg
tttaacgaagtagatatgagtgccgtaatggaactcagaaatcgatataaggataaattt
aaagaagcgcataacgtaagtcttggatttatgagcttttttactaaggctgcgatccat
gcgctaaaaacaattccggcgatcaatgcagaaatccgtggaagtgatattgtttacaaa
aattattatgacataggggtcgctgttggaggaccgaagggactggtcgttcctgtcgta
agagacgcggacttgctcagttttgcaggagtagaacaagagattataagacttgcgaat
cgggtcaaagacggaaaaattgaacttgctgaaatggaaggtgggacgtttacgatttcc
aatgggggaatctacggttctatgatgtccactccaattctcaatcccccacaaagtgga
attttaggacttcataatatagtaaaacgtgctgtggtggtaaacgatcagatcgtgatt
cgtccgatgatgtatcttgcactttcctacgatcatagaatcgtagatggaaaggaggcg
gtcactttccttgtaaaggttaaggaagcgatcgaagatccaagtcggcttttactagaa
ctttaa

DBGET integrated database retrieval system