KEGG   Leptospira interrogans serovar Copenhageni: LIC12629Help
Entry
LIC12629          CDS       T00166                                 

Gene name
ech3
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LIC12629 (ech3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LIC12629 (ech3)
   00650 Butanoate metabolism
    LIC12629 (ech3)
  Lipid metabolism
   00071 Fatty acid degradation
    LIC12629 (ech3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LIC12629 (ech3)
   00310 Lysine degradation
    LIC12629 (ech3)
   00360 Phenylalanine metabolism
    LIC12629 (ech3)
   00380 Tryptophan metabolism
    LIC12629 (ech3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LIC12629 (ech3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LIC12629 (ech3)
   00281 Geraniol degradation
    LIC12629 (ech3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LIC12629 (ech3)
   00627 Aminobenzoate degradation
    LIC12629 (ech3)
   00930 Caprolactam degradation
    LIC12629 (ech3)
Enzymes [BR:lic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LIC12629 (ech3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:3180828..3181655
Genome map
AA seq 275 aa AA seqDB search
MKTHFEFFEIVPKPEDKTAILYLNRPEKRNAMNWPFWRDLPDTIEEINSNPDIHSFVIAA
RGKSFSTGLDLDSFIQQFGSIIQAPLGSDRRKFFDLILKMQKGINAVYDSPKPSIAAVQK
HCIGGGLDLISACDIRYATVDASISLREAKVAIVADMGSINRLPSIIGQGHTRELALTGK
DIDGPEAERIGLVTKVFSTEEEMMNAALATAKEIAENPKIVVSGIKDVMRYSEGKPLDAG
LNYVALWNSSFLDSADFRGAMQSFRERKRPVYNQS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccattttgaattttttgaaatcgttccaaaaccagaagacaaaactgctatc
ctttatctcaatagacccgaaaaaagaaacgcaatgaactggcctttttggagagatctg
ccagatacaatcgaagaaattaactcgaatccggatattcattcgtttgtgatcgccgca
agaggtaaatctttctccaccggtttagatctggattcttttatccaacagttcggaagt
ataatccaagctcccttaggtagcgatcgaagaaagttctttgatctcattttaaaaatg
caaaaaggaatcaatgcagtttacgattcccctaaaccttccatcgcagcggttcaaaaa
cattgtatcggtggcggtttagatctgatctccgcctgcgatattcgttatgctaccgtg
gacgcgtctatctctcttagagaagcaaaagtagcgattgtcgcagatatgggttctatc
aacagacttccttctatcatcggacaaggtcatacaagagaattggccttaaccggaaaa
gacatagacggaccagaagcagaaaggataggacttgttactaaagtattttcaaccgaa
gaagaaatgatgaacgcagctcttgcaactgcaaaagaaatcgctgaaaatcctaaaata
gtcgtatccggaattaaagacgtaatgagatattctgaaggaaaaccgttagacgccggt
ttaaattatgttgctctttggaattctagctttttagattccgcagattttagaggagca
atgcaatcttttcgggaacgcaaacgccccgtctataatcaatcttaa

DBGET integrated database retrieval system