KEGG   Leptospira interrogans serovar Copenhageni: LIC12786Help
Entry
LIC12786          CDS       T00166                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lic01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lic00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3391956..3392714)
Genome map
AA seq 252 aa AA seqDB search
MSSSQPHRVLREIISTKQNEIKKISAWDPLPHRGLSLRDSLKSRTFSIIAECKRKSPSAG
ELRADYRPVQIAKTYEELGASAISVLTDQNYFGGSLEDLKDVSSELKIPVLRKDFILDEI
QIREARAFGASAILLIVRILTPEQIKSFLKLASSLGMDCLVEVHTSDEAKLALDCGAEII
GINTRDLDTFQIHQNLVEEVSAFLPPNIVKVGESGIKKRSDLDTFRKLVDAALIGTYFME
KQDIRKAWLNLF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctcaacctcaccgggttctccgggaaatcatttctacaaaacaaaatgaa
atcaaaaaaatttcagcctgggaccctcttccacatcgtggtctcagtcttcgtgattct
ttaaaaagtagaaccttttccattattgcagagtgtaaacgaaagagtccatcggccggt
gaacttcgtgcggattatcgtccggttcaaatcgctaaaacatacgaagagttaggcgct
tctgctatttctgtacttacggatcagaattactttggaggttctttggaagatctgaag
gacgtctcttcagaattgaaaattccagttttaagaaaagattttattctggatgaaatt
cagattcgggaagcaagggctttcggtgcatccgcaattttattgatcgtcagaattttg
actccggaacagattaagtcttttttaaagttagcttcttctttgggaatggattgtttg
gttgaagttcatacttcggatgaggcgaaacttgctctggattgtggtgcggaaattatt
ggaatcaatacgagagatttagatacgtttcaaattcatcagaatctggtagaagaagta
tccgccttcttaccacctaacatagtaaaagtaggtgaatccggtataaaaaaacgttcc
gacttggacacttttcgtaaattagtggacgcggctttgatcgggacctattttatggaa
aaacaagatattcgaaaagcctggttgaatttattttag

DBGET integrated database retrieval system