KEGG   Leptospira interrogans serovar Copenhageni: LIC13195Help
Entry
LIC13195          CDS       T00166                                 

Definition
cholesterol oxidase precursor
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
lic  Leptospira interrogans serovar Copenhageni
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3915816..3917384
Genome map
AA seq 522 aa AA seqDB search
MSKDNTRYDAIVIGSGFGGSISALRLSEKGQRVLVLERGKKYSPGDFPRDVRKIDNLLWR
YPKKKKSLGLYELNFFSGLGTVTASGLGGGSLIYANIHIRPDHKVFEDPRWPAPFNRDYL
DPYFDKVASKFDVKPVPPEWDLPKRNRFKAAADLNRHTHFDPDAAASWLKPSRPGQSTCI
RCAECEFGCNHGAKNTLDFNYIADAEKNGAVFQTNSLASHIAPDSQNGYVVYYENTETGE
KKSVYAKRVILSAGTLGTNRILFNSRDRYKTLPNLSKQLGKGYSGNGDFLGGIESSKSEL
IPWDGPDVTTVINYFPQGFQFTMAAPTFSQPVMSVLASLGIAKPNWFLKLIGPIFWKSLK
WILPFVFKKGLLSKPLPPGLPGAGNPNYMTNLFAIGRDNANGKIVRRGKNIDVKWKYSKE
NQTLIQNMTASMQQIGDAYGGQFGPLATFLLFNRIISVHSLGGCILSANPDKGVVSETGE
VFGYKNLFIADGSVIPSSIGFHPVMTISAVAEHTAASICAGL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagataatactcgttacgacgcaatcgttattggctctggatttggtggttcc
atcagcgccttaagactttcagaaaaaggccaaagggttttagtattagaaagaggaaaa
aaatattctcccggagattttccaagggacgtacgtaaaatagacaatcttctctggcgt
tatcccaaaaagaaaaagtctttgggtttatacgaactcaatttttttagtggactcgga
accgtaaccgcttccggtttaggcggaggttccttgatctacgcgaatattcatatccgt
cccgatcataaggtttttgaagatcctcgctggccagctccgtttaacagagattatttg
gatccctattttgataaagttgcctctaaatttgatgtaaaaccggttccaccagaatgg
gatcttccaaaaagaaatagatttaaagccgctgcggatttaaacagacatactcatttt
gatccggatgcagctgcaagttggctaaaaccttccagaccaggacaatctacttgcata
cgttgtgcggaatgtgagttcggatgtaatcacggagctaaaaacacattagattttaat
tatattgcagacgccgaaaaaaacggtgccgtgtttcaaaccaattccctagcatctcat
atagccccagatagtcaaaacggttacgtagtttattatgaaaatacggaaaccggagaa
aaaaaatcggtatatgctaaaagggtcatactttccgcaggaacgttaggtacaaatagg
attctttttaacagcagagacagatacaaaaccctaccaaatctaagcaaacaacttgga
aaaggatattctggaaatggggactttttaggcggaattgaatcgagtaaaagtgaactc
ataccttgggacggaccggacgtaactaccgtaatcaattattttccacaaggatttcaa
tttacaatggcagcgcctacgttcagtcaaccggtaatgtcagtacttgcttcattagga
attgctaaaccgaattggtttttaaagctgattggtcctatcttttggaaaagtttgaaa
tggattcttccttttgtatttaaaaaaggattactttccaaacctctaccacctggtctt
ccgggagcgggtaatccaaactatatgacaaatctatttgccataggaagagacaatgca
aatgggaaaatcgtacgtcgtggcaaaaacatagacgtgaagtggaagtattctaaagaa
aaccaaaccctcattcagaacatgactgcttctatgcagcagataggagacgcatacggc
ggacagttcggtccgttagctacctttttgttattcaatcggatcatctcagttcattct
ttaggaggttgtattctttccgccaatccggacaaaggagttgtatccgaaacgggagaa
gtattcggttataaaaatctattcattgccgatggatctgtaattccttcttcaatcgga
tttcatcctgtgatgacaatttccgccgtggccgaacatactgcagcttccatctgtgcc
ggattataa

DBGET integrated database retrieval system