KEGG   Leptospira interrogans serovar Copenhageni: LIC13251Help
Entry
LIC13251          CDS       T00166                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lic00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lic00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3989142..3990440
Genome map
AA seq 432 aa AA seqDB search
MRSSYFKIIGKTPLHGTVVPQGNKNEALPLLGAVCMVPGTVRISNIPVISDVLMLMEVLR
HLGMEITEEEPGTYIFKHDGNLKNQLPEELCSRIRGAVTLAGPILAMTGRVFLPKPGGDK
IGRRRLDTHLLALQALGASIEVFPDGYEIKADQLKGTDILMDEASVTGTENAVMAAVFAE
GTTILRHAASEPHVQRLCHFLNSAGAKISGIGSNILTIEGVTSLKPPAKEHKIGSDYLEV
GSFISLAAVTGGELMIRDVELEDIRMIRMVYSRLGIEVRPHENGILVPSDQKMEIIPDYH
GATPKIDDSPWPGFPADMTSVALVTATQCKGTVLIHEKMFESRLFFVDNIIAMGAQIILC
DPHRAIVIGHSRLYGQKVASPDIRAGMAMIIAALCAEGTSYIHNIGQIDRGFENIDTRLR
ALGARIERVNAD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagatcttcgtattttaagatcattggaaagacccctcttcatggaaccgtggttcca
caaggaaataaaaacgaggcattaccattgttaggagcggtctgtatggttccgggaacc
gttcgtattagcaacattcctgtaatctcagacgtactcatgcttatggaagttcttcgt
catctcggtatggaaatcaccgaagaagaacctggaacttatatttttaaacacgatgga
aatctaaaaaatcaacttcccgaagaactctgttctcgcattcgaggtgcggtcacctta
gcaggtccaattcttgcgatgactggaagggtttttttaccaaaaccaggcggagacaaa
ataggaagaagaagactagacactcatcttctcgcattacaagcattaggtgcaagtata
gaagtattcccggacggctatgagattaaagcggatcaactaaaaggaacggacatactt
atggacgaggcttccgttaccggaaccgaaaacgcggtaatggccgcggtttttgcagaa
ggtactacaatccttcgtcacgccgcaagcgaacctcacgttcaaagactttgtcatttt
ttaaattctgcaggagccaaaatttcaggaatcggttctaacattcttacgatcgaaggt
gtaacttctttaaaacctcccgccaaagagcacaaaataggatctgattatttagaagtg
ggttcgtttatcagtttggccgcagtcacaggcggagaacttatgattcgagacgtagaa
ttggaagacatccgtatgatccgaatggtttattctcgtcttggaatcgaagtgcgtcca
catgaaaacggaattttagttccttccgatcagaagatggaaattattccggattatcat
ggtgcaactcctaaaatagacgattctccttggcctggttttcctgcggatatgacttct
gtcgcgctcgttaccgccactcagtgcaaaggaacagttttgattcacgaaaaaatgttc
gaatccaggctcttctttgtagataatatcatcgcaatgggagcacagattattctttgt
gatccacatcgtgcaatcgtaattggtcattctagactttacggtcaaaaagtagccagc
ccagacatacgtgctggtatggcaatgatcattgctgctctttgtgcagaaggcacaagt
tacattcataatataggtcaaatcgacagaggttttgaaaacatagatacccgcttacgc
gcgttaggtgcaagaatcgaaagagtaaacgcagattga

DBGET integrated database retrieval system