KEGG   Leptospira interrogans serovar Copenhageni: LIC13442Help
Entry
LIC13442          CDS       T00166                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lic00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lic00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(4218825..4219322)
Genome map
AA seq 165 aa AA seqDB search
MRFDMNDTLYDLTATLNNGKEQKLENYKGKVLLIVNTASECAFTPQYAGLQNLYSKYKTE
GLEILGFPCDQFKHQEPGSDETIKNFCQKNYGVEFPIFKKIEVNGDNAHPVFRFLRNKAS
GFFGNSIKWNFTKFLVDKQGNVIKRYSPITTPENIEKEIQNLLKR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttcgatatgaacgatacattatatgatttaacagcaactttaaataacggaaaa
gagcaaaaattagagaattataaaggaaaagtactcttaatcgtaaataccgctagcgaa
tgcgcttttacaccacaatatgcaggtttacaaaatttatatagtaagtataaaactgag
gggttggaaattttaggttttccgtgtgatcagttcaaacatcaggagcctggttctgat
gaaacgatcaaaaacttttgtcaaaagaattacggagtagaatttcctatttttaaaaaa
atagaagtaaatggagataacgctcatccagtatttcggtttttgagaaacaaggcttct
ggtttttttggaaattcgatcaaatggaactttactaaatttttagtggataaacaagga
aacgtaataaaacgttactcccccattacaactccagaaaacatcgagaaagaaatccaa
aatcttttaaaacggtaa

DBGET integrated database retrieval system