KEGG   Leptospira interrogans serovar Copenhageni: LIC13476Help
Entry
LIC13476          CDS       T00166                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LIC13476 (recR)
DNA repair and recombination proteins [BR:lic03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LIC13476 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:4250006..4250611
Genome map
AA seq 201 aa AA seqDB search
MAENLANHLLDEMIEALSSLPGIGRKSAFRISFHLLRLEQGLFNQFIHQLTDTKNKIKFC
KRCGSYAETEICEICVSEKRDSHTFCVVEQPEDIFFIENTREFQGKYHVLNGVISPLEGI
GPRDLRIKELLERIEPEQVKEVLIATNPTLEGDATADYLANQLKPISVNVTRIAYGITVG
GSIELADQYTLGRAIRSRLQL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttggcggaaaatttggctaatcatcttcttgatgaaatgatagaagctctttcttctctt
ccaggaattggaagaaaaagcgcttttagaattagttttcatcttttaagattagaacaa
ggtctttttaaccaattcattcatcaacttacagatacaaaaaataaaatcaaattttgc
aaacgttgcggctcttatgcagaaactgaaatttgcgagatctgtgtttccgaaaaaaga
gattctcatactttttgcgtagtagagcaaccggaagacattttttttattgaaaacaca
agagaatttcagggcaaataccacgtgttaaacggagtcatttctcccttagaagggatc
ggtcccagagatcttagaatcaaagaacttttggaaagaatagaaccagaacaagtaaaa
gaagttttgatcgctactaacccgaccttagaaggagacgcaacagccgattatttagca
aatcaattaaaacctatttcggttaatgtaactagaatcgcttatgggattacggtcggt
ggttcgatcgagcttgctgatcaatatactttaggaagagcaattcgttctcgtcttcaa
ctttag

DBGET integrated database retrieval system