KEGG   Leptospira interrogans serovar Copenhageni: LIC20010Help
Entry
LIC20010          CDS       T00166                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lic00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:8835..9788
Genome map
AA seq 317 aa AA seqDB search
METKQRRIRLNAGLRNLASSESLNSKKLIQPIFIVEGLKEKEKMDSLPGVFRDTESSVFK
QVELDLKAGVTHFILFLIPELKSNSEIPKSFYERSISSLKKKFPESFLWIDTCMCSLTTH
GHCGLLHPDGSIDNHTSVKHLSDIALVYAQSGADGIAPSDMMDGRIKSHRSILDLNGFSN
IPILSYSTKFKSNFYGPFRAAADSAPAQGDRSSYQIDVRNREDAVLSSIRDKEEGADFLM
VKPGMTSIDLIGPIREKTGLPTGVYQVSGEYASIHYLSQNGFCDFDSALSETWQIFSRAG
ASYLITYAARRGKEILS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaccaaacagagaagaattcgccttaacgctggacttagaaatcttgcgtcttcg
gaaagtttaaattcaaaaaaactaatacagcctatttttatcgtggagggtttaaaagaa
aaagaaaaaatggattctcttcctggggtttttagagatacggagtcttctgtttttaag
caggtagaattggatctcaaggcaggagtgactcattttatactttttcttatcccggaa
cttaaatccaattcggagattcctaaatccttttatgaacgttctatttcttctttaaag
aagaaatttccagaatcctttttatggatagatacttgtatgtgttctcttaccactcac
ggtcactgcgggcttttgcatccggatggaagtatcgataaccacacttctgtaaaacat
ctttcggatattgctttggtttacgcgcaatccggtgccgatgggattgcaccaagcgat
atgatggacggaagaattaaaagccaccgttcaattttagatctaaacggattttcgaat
attccaattttaagttattctactaaatttaaaagtaacttttatgggccgtttcgtgcg
gctgccgattctgctccggctcaaggggatcgttcttcgtaccaaatagacgttcgaaat
cgggaggacgctgttctttcttctatacgtgataaagaagaaggtgcggactttctgatg
gttaaaccaggaatgacttccattgatcttattggtccgatccgtgaaaaaacgggactc
cccacgggagtttatcaagttagtggagaatacgcttcgatccattatctttcacaaaac
ggtttttgtgactttgattctgcgttatccgaaacttggcagattttttccagagcgggg
gcttcttatctaattacgtatgccgccagaagaggtaaggagattttatcttga

DBGET integrated database retrieval system