KEGG   Leptospira interrogans serovar Copenhageni: LIC20017Help
Entry
LIC20017          CDS       T00166                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lic00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:16251..17534
Genome map
AA seq 427 aa AA seqDB search
MRTQSPDYIVIGAGFTGLLYSTLAVLEGRSVFLYEKQNRSGGLVGSIQTPFGLVETAANG
ILNSYQLEELASALGLKILTTEKKSKKRFIWKNGSPRRFPLSFLDTLRVLYGILGISAEI
RAGESVYQWGVRVLGKGAVKNVLEPGLGGIYAGNLKDMSAELALGGWISSKGSLLKNIRE
IKKIKTKNPKQKKGTVSFRGGLGELLNAMEAKIKSSPNSKIYYSQESPTLSSIRKKYPNS
KIILSCGLESSLKLLSSGFPVFKRYEKLCKTLGVVTVTRFGNQPLLGKKSGFGILFPSDS
GFRTLGVLLNSSIFSGRVSKGHYSETFIFGGALDQEIVKFKEKEIINVLEEDRKKITVQN
DEPLNHYVTIWKSALPIYDLALLEFNKELDRSLPEGIFVEGNFRYGIGLSSILERAWNVM
RNQKGRT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacacaatcaccggattatatagtcatcggagcgggttttaccgggcttctttat
tctactcttgccgttttagaggggaggtctgtgtttctttatgaaaaacagaatcgatct
ggaggattggtagggtccatccaaacaccttttggacttgtagaaactgcggcaaatgga
atcctaaattcgtatcaactcgaggaacttgcttccgcgcttggtctgaaaattcttacc
acagaaaaaaaatcaaaaaaaagatttatctggaaaaacggatctcctagaagattccca
ctctcttttttagacaccttacgtgtgttatatggaattttaggaatttccgccgagatt
cgagcgggagaatccgtttatcagtggggagttcgtgttttggggaaaggtgcggtaaaa
aacgtattggagcctggccttggcggaatttatgccggaaatttaaaggatatgtccgct
gaactcgcgttaggaggttggattagttccaagggttcccttctaaaaaatatccgtgaa
attaaaaaaataaaaacaaaaaatccaaaacaaaaaaaaggaacggtgagttttaggggt
ggtttaggagaacttctaaacgcaatggaagcgaaaattaaatcgtctccaaattctaag
atatattattcgcaagaatcccctactctaagctcgattagaaagaaataccctaattca
aaaattattctttcctgtggtttagaatcttctttaaaattattatcatcaggttttcca
gttttcaaaagatatgaaaagttatgtaaaaccctaggagttgtaaccgtcactcgattt
ggtaaccaacctttgctcggaaaaaagagtggatttggaattctttttccttctgattct
ggttttagaactctaggagttttactcaactcttctattttttcgggaagagtttctaaa
ggacattactcggaaacttttatctttggaggagccctagaccaagaaatcgtaaaattt
aaagaaaaggaaattataaacgtattagaagaggatcgaaaaaaaataaccgttcaaaat
gacgaaccactcaatcactacgttacgatttggaaatcagctcttccaatatacgattta
gctcttcttgaatttaacaaagaattagatcgaagtttgccggaaggaatttttgtagaa
ggaaattttagatatggcatcggccttagttccattttagaaagagcctggaacgttatg
cggaatcaaaaaggacgtacataa

DBGET integrated database retrieval system