KEGG   Leptospira interrogans serovar Copenhageni: LIC20017Help
Entry
LIC20017          CDS       T00166                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIC20017 (hemG)
Enzymes [BR:lic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LIC20017 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:16251..17534
Genome map
AA seq 427 aa AA seqDB search
MRTQSPDYIVIGAGFTGLLYSTLAVLEGRSVFLYEKQNRSGGLVGSIQTPFGLVETAANG
ILNSYQLEELASALGLKILTTEKKSKKRFIWKNGSPRRFPLSFLDTLRVLYGILGISAEI
RAGESVYQWGVRVLGKGAVKNVLEPGLGGIYAGNLKDMSAELALGGWISSKGSLLKNIRE
IKKIKTKNPKQKKGTVSFRGGLGELLNAMEAKIKSSPNSKIYYSQESPTLSSIRKKYPNS
KIILSCGLESSLKLLSSGFPVFKRYEKLCKTLGVVTVTRFGNQPLLGKKSGFGILFPSDS
GFRTLGVLLNSSIFSGRVSKGHYSETFIFGGALDQEIVKFKEKEIINVLEEDRKKITVQN
DEPLNHYVTIWKSALPIYDLALLEFNKELDRSLPEGIFVEGNFRYGIGLSSILERAWNVM
RNQKGRT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacacaatcaccggattatatagtcatcggagcgggttttaccgggcttctttat
tctactcttgccgttttagaggggaggtctgtgtttctttatgaaaaacagaatcgatct
ggaggattggtagggtccatccaaacaccttttggacttgtagaaactgcggcaaatgga
atcctaaattcgtatcaactcgaggaacttgcttccgcgcttggtctgaaaattcttacc
acagaaaaaaaatcaaaaaaaagatttatctggaaaaacggatctcctagaagattccca
ctctcttttttagacaccttacgtgtgttatatggaattttaggaatttccgccgagatt
cgagcgggagaatccgtttatcagtggggagttcgtgttttggggaaaggtgcggtaaaa
aacgtattggagcctggccttggcggaatttatgccggaaatttaaaggatatgtccgct
gaactcgcgttaggaggttggattagttccaagggttcccttctaaaaaatatccgtgaa
attaaaaaaataaaaacaaaaaatccaaaacaaaaaaaaggaacggtgagttttaggggt
ggtttaggagaacttctaaacgcaatggaagcgaaaattaaatcgtctccaaattctaag
atatattattcgcaagaatcccctactctaagctcgattagaaagaaataccctaattca
aaaattattctttcctgtggtttagaatcttctttaaaattattatcatcaggttttcca
gttttcaaaagatatgaaaagttatgtaaaaccctaggagttgtaaccgtcactcgattt
ggtaaccaacctttgctcggaaaaaagagtggatttggaattctttttccttctgattct
ggttttagaactctaggagttttactcaactcttctattttttcgggaagagtttctaaa
ggacattactcggaaacttttatctttggaggagccctagaccaagaaatcgtaaaattt
aaagaaaaggaaattataaacgtattagaagaggatcgaaaaaaaataaccgttcaaaat
gacgaaccactcaatcactacgttacgatttggaaatcagctcttccaatatacgattta
gctcttcttgaatttaacaaagaattagatcgaagtttgccggaaggaatttttgtagaa
ggaaattttagatatggcatcggccttagttccattttagaaagagcctggaacgttatg
cggaatcaaaaaggacgtacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system