KEGG   Leptospira interrogans serovar Copenhageni: LIC20052Help
Entry
LIC20052          CDS       T00166                                 

Gene name
scd
Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lic01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lic01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:52991..53812
Genome map
AA seq 273 aa AA seqDB search
MGIILSFFIGHWFLSAFVQSFFLHRYAAHAMFKMNKFWEKFFYIFTCVAQGSSFLNPRAY
AIMHRQHHAYSDTGKDPHSPVASKGFLDMMWKTALNYEAILEETTNVEKEFKGNYPEWPA
IDVLSNSWTFRLFCGTLYTLFYFYFVPEGQYAWYLLLPIHWLMGPLHGAIVNWCGHMYGY
RNHKKNPDNSKNTLFVDFMIAGELYQNNHHAHPNSPNFAFRWFELDFTYQVMKILHFFRI
IKIQRAVWTEKGKKILRGSEVLVEPTSTSTVAA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggggatcattctatcttttttcattgggcactggtttttatctgcttttgttcaatcg
ttttttcttcatagatatgcggcacacgcaatgttcaaaatgaacaaattttgggagaag
tttttttatatttttacttgtgtagcccaaggctcttcttttttaaatccacgtgcttat
gcgattatgcacagacaacaccatgcttatagcgatacaggtaaggacccgcattctccc
gtagcttctaaaggttttttggatatgatgtggaaaactgctctcaattatgaagcgatt
ttagaagaaacaacaaacgtcgaaaaggagtttaaaggaaactatcctgaatggcctgcg
atcgacgttctcagtaattcttggactttcagacttttttgtggaacactttatacttta
ttttatttttactttgtccctgaagggcagtatgcttggtatctacttctgccgatccat
tggcttatggggccgttgcatggagcaatcgtaaactggtgcggtcatatgtatggatat
agaaatcataaaaaaaatccggacaattctaagaatactttatttgtagattttatgatc
gcaggagaattatatcagaataatcatcacgctcatccaaattctccgaacttcgcgttt
cgttggttcgaactggattttacttatcaagtaatgaaaattttgcattttttcagaatt
atcaaaatccaaagagcagtctggaccgaaaaaggaaaaaaaatacttcgcggttcggag
gtacttgtggaacctacgtccacttctacggttgccgcttaa

DBGET integrated database retrieval system