KEGG   Leptospira interrogans serovar Copenhageni: LIC20199Help
Entry
LIC20199          CDS       T00166                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lic00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LIC20199 (galU)
   00052 Galactose metabolism
    LIC20199 (galU)
   00500 Starch and sucrose metabolism
    LIC20199 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LIC20199 (galU)
Enzymes [BR:lic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LIC20199 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(254973..256391)
Genome map
AA seq 472 aa AA seqDB search
MDSLKSKSDELIQNKMTSEGLSSAFIQDFLKKTDLVRNGETGMVRWEEVGDLDPKADEIT
LEQIESENAPEPSILKNLVVIKLNGGLGTSMGLSGPKSLIELKNGMSFLEIVAKQSEVIE
KKYNVSVPLILMDSFNTQKESQEELNRIGFRQKFPTSFLQHKVPRLLKKDLTPISCKNPD
EEWCPPGHGDIWISLLETGLLDTLIQNGYKIAFVSNGDNLGATVHPGILSYMLKEKLEFC
MEMTPKTLADKKGGAIYKRMIAGRAENYQLLETAQVPPEHMHEFEGLGKFRTFSTNNLWI
DLVALRQRILLGSFELSLIVNPKTIEGQEVLQLETAMGSAIRNFEKVKGIIIPRDRFAPV
KKCEDYLARRSDAYHLLENYSITMSDKRKESGLGEILIYLDERYYKKIGDFNRLFPEIPS
LELCSSLTVQGEVLFDQKISIVGEVVIQNNETLPRRISDLKTRILESGKYSF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggattcgctaaaatcgaaatcggatgaactcatccaaaataaaatgacttccgaaggt
ttatcttctgcttttatccaagactttttgaaaaaaaccgatctggttcgaaacggagaa
accggaatggttcgctgggaagaagtaggagatctagatcctaaagcggacgagattact
ttagaacaaattgaaagtgagaatgctcccgagccttcgattcttaaaaacttagtcgtt
atcaaactcaatggtggacttggaacttctatgggactctccggtcctaaatctttaatt
gaactcaaaaatggaatgtcctttttagaaatcgttgcgaaacaatctgaggtcattgaa
aaaaaatataatgtgtctgttcctttgattctaatggacagttttaatacacaaaaggaa
agtcaagaggagttgaatcggatcggattccgtcaaaaatttcccacttcttttttacaa
cataaagtgcctcgtcttttgaaaaaggacctaacacctattagctgcaagaatccggat
gaagaatggtgtcctcccggtcacggtgatatatggatttctcttttggaaactgggctt
ttagacactctcattcaaaacggatacaaaattgcttttgtatccaacggagacaactta
ggagctacggtacatccaggaattctttcctatatgttgaaagagaaactggaattttgt
atggagatgactcctaaaactcttgcggataaaaagggcggagcgatctacaaaagaatg
attgccggaagagcggagaattatcaactcctcgaaacggctcaggttccacccgaacac
atgcacgaatttgaaggtttaggtaagttcaggactttttcaacaaacaatctttggatc
gatttggttgcccttcgacaaagaattcttctcggaagttttgaactttctctgatagta
aatccaaaaacgatcgaaggacaagaagttctacagctcgaaactgcgatgggttccgcg
atccgaaattttgaaaaggtcaaagggatcatcattcctagagatagatttgctcctgta
aaaaagtgcgaggattacctcgctcgtagatcggatgcgtatcaccttttagaaaactat
tctattaccatgtccgacaaaagaaaagaatccgggttaggcgaaatactgatttatctg
gatgaaagatattacaaaaagattggagactttaatcgactttttccagaaattccttct
ttagaactttgttcttctcttaccgttcaaggagaagttctattcgatcaaaaaatttcc
atcgtgggagaggttgtaattcaaaataacgaaacactacctcggagaatatcagattta
aaaactagaattttagagtctggaaaatattccttttaa

DBGET integrated database retrieval system