KEGG   Leptospira interrogans serovar Copenhageni: LIC_13366Help
Entry
LIC_13366         CDS       T00166                                 

Definition
(GenBank) putative strictosidine synthase
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
lic  Leptospira interrogans serovar Copenhageni
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:lic01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     LIC_13366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:4128459..4129535
Genome map
AA seq 358 aa AA seqDB search
MFKRIVIFLFILIFLSLSFLIFLFLRSSKNTNESITDSPFDPGKNNYLLESEWIHKENLN
QPYAIAIDARGYVYTGTADHKVVQIRTNEKIETFAVLSGRPLGMVFDSHGNLLVCVEEVG
IVKIRKDGSQKTIISKLPDGSPLRFPHGIDISKDGKIYFTVSSQSYSLQESFLEELFSRP
NGMIVTADKNLTLEILNQDLYYPTGIALSSNEEFLLVSEPFRHRISSIPIFGSQRGTEKF
FLTNIPGIPALISGNGGFFWVGIPYHRNEILDKTQEYPEIKNLLTGLPVFLFGKNIPRGL
VFALNDFGDITANYQDFSDSSVAGITAVLNHAGNIYLVSSTIGKIAKMKPIIEEIQFF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaattgtaatattcctttttattcttatttttctttctttatccttcttg
atttttttatttttacgttcaagtaagaatacaaatgaatctatcacggattctcctttt
gatcctggaaaaaataattatcttttagaatcggaatggattcataaggaaaatttaaac
caaccttacgcaatcgctatagacgctcgcggttatgtctatactggaaccgcagatcat
aaagtcgtacaaatccgtactaacgaaaaaatagaaaccttcgccgttctttcaggaagg
cctttaggaatggtatttgattctcacggaaatcttttggtttgtgtagaagaagttgga
atcgtaaaaattcgtaaagacggatcacaaaaaactattatctctaaacttccggacggt
tcacctcttcgatttccacatggaattgacatttctaaagacggaaaaatatatttcacc
gtttccagccaatcgtattcattacaagaatcttttttagaagaacttttttctcgccca
aacggaatgatagtaacagcggataaaaatcttacattagaaattttgaatcaagatttg
tattatcctactggaatcgcattgtcatctaacgaagaatttttactcgtatcggaacca
tttcgacatagaatttcctcgattccgatattcggttcccaaagaggtacggagaaattt
tttcttacgaatattcccggaattcccgctttgatcagtgggaacggaggttttttctgg
gtcggaattccatatcatagaaatgaaattttagataaaacccaagaatatcccgaaatt
aaaaacctactgacaggtttacctgtttttctttttggaaaaaatattccgagaggtttg
gtatttgctttaaatgattttggagatattacggccaattaccaagatttttcggattct
tcggttgcaggtattaccgcagttttaaaccacgccggaaatatttatttggtatcttcg
accatcggaaaaatcgcaaagatgaaaccgataatcgaagaaattcaatttttctaa

DBGET integrated database retrieval system