KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0031Help
Entry
LIF_A0031         CDS       T01983                                 

Gene name
lacA
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LIF_A0031 (lacA)
Enzymes [BR:lie01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LIF_A0031 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(37450..39426)
Genome map
AA seq 658 aa AA seqDB search
MIFGADYYPEQWTRKDWEEDISIMKEMGLSSIRLAEFAWAMMEPKEGKYDFSFFDHILSL
IQKNEMTAILGTPTATFPPWLAKKFPDIIQERDGIQRTIGTRRQACFSSPNYRKAVIKIV
TAMAKHFGNHPVVIGWQIDNEIGHEGSDIDHSQTSLKAFRIWLKNKYKTIQNLNETWGNV
FWGMIFNSFEEIPIPGRHVASNFHPSLIQDFYRFHSDTIIDFVKLQAQILRKFSVGRPLT
TNLYPSPFLPIIDMAELATYLDYISWDNYPTWGEQEAPFPHPFISAMQQYNRGLKNLPFT
VMEQISGFQGHDLLGYLPAPGQTKLWMKHSIAHGSNAIYFFRYRTARFGQEQLCYGILDH
DKKKTERYYELQKGIQEIEKYTEDFTEELFPAEVALVHDIENARNWKHQPISTGLKFSPV
PWSQVGYDIEMATWFSGMNVLNVNTHFRPASKIDFKNYKIIILPMYTMVNETVFKRLEEF
VREGGTLVLGFRTGAKDLNGWMYDSQIPGPFAEMAGIKIRKFESVGNQKVKFRFRFFPGT
CSKICEILEPTTAEVWARYTDGKKFYKGSPVITANNYHKGKVIYVGSSLEPLSFVLLYRR
ILKEAKIPFIFYGPNVEKIFRSGRKQNYEIFINHSGKKSLAGLKILDPYEVRILSKKK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatattcggagccgattactatccggaacaatggactcgaaaagattgggaagaagac
atctctattatgaaagaaatgggtttgagttcgattcgtcttgcggagtttgcttgggcg
atgatggaacctaaagaagggaaatacgatttttctttttttgatcatattctaagttta
atccaaaaaaacgaaatgaccgcgattttaggaacccccacggcaacctttcctccttgg
cttgctaaaaaatttccagacataatccaggaaagagatggaattcagaggacaattggc
accagaagacaggcttgtttttcttcacctaactatagaaaggcggtgataaaaattgtg
accgcaatggctaaacattttggaaatcatcctgtggtaattggttggcaaatcgataac
gaaatcgggcatgaaggttctgatatagatcattctcaaacatctctaaaagcttttcga
atttggttaaaaaataaatataaaacgattcaaaacttaaatgaaacttggggaaatgtt
ttttggggaatgatttttaattcttttgaagaaattccgattcctggtcgacacgttgcg
agcaattttcatccttctttgatccaagacttttatcgatttcattcagatacaatcatc
gatttcgtaaaacttcaggcacaaattcttagaaaattttcagtcggaagacctctcact
actaacctctatccttctccatttttaccgattattgacatggcagagttggccacctat
ttagattatatttcttgggacaattatcctacttggggagaacaagaagctccgtttcct
catccgttcatctctgcgatgcaacaatacaaccgaggtttaaaaaatcttccatttact
gttatggaacaaatttctggttttcaaggacacgacctacttggttatcttccggctccc
ggacaaaccaaactttggatgaaacattctattgcacacggttcaaatgcgatttatttt
ttcagatatagaaccgcgcgtttcggtcaagaacaactttgttacgggattttagatcac
gataaaaaaaagacagaacgttattacgaacttcaaaaaggaatccaagaaattgaaaaa
tacacggaggattttacagaagaattatttccggctgaggttgctctcgtacacgacata
gaaaatgctagaaattggaaacaccagcctatttccaccggattaaaattctcacctgtt
ccttggtctcaagttggttatgatattgaaatggctacttggttttctggcatgaacgtg
ttaaacgttaacactcatttccgtcccgcttctaaaatcgattttaaaaattataaaatt
ataatacttccaatgtatacaatggttaacgaaacagtttttaaacgtttggaagaattt
gtaagagaaggtggaactttagttttaggttttagaactggagctaaagatttaaacgga
tggatgtatgattctcaaattccgggaccatttgcagaaatggctgggattaaaattcga
aagtttgaatcggtaggcaatcaaaaggtcaagtttcgttttcgtttttttccgggaact
tgttctaaaatttgtgaaattttagaacctaccacagcggaagtttgggctcgttataca
gatggaaaaaaattctacaaaggaagtcccgtaatcactgcaaataattatcataaagga
aaagtcatttacgtaggatcttctttagaacccttaagttttgttcttctttatagacgt
attttaaaagaagcaaaaattccattcattttctacggacccaatgttgagaaaattttt
agatcgggaagaaaacaaaattatgaaatctttattaatcattccggaaagaaaagtctt
gcaggtttaaaaattttagatccttatgaagttagaattctttctaaaaagaaatga

DBGET integrated database retrieval system