KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0051Help
Entry
LIF_A0051         CDS       T01983                                 

Gene name
folP
Definition
dihydropteroate synthase
Organism
lie  Leptospira interrogans serovar Lai IPAV
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1:62364..63206
Genome map
AA seq 280 aa AA seqDB search
MESKQDSNSSSYSTKIFGVLNITEDSFSDGGKYLTFKSSSEKANSLLNQGADVIDIGAQS
SNIQASLIGPEIEWIRMKELISNLVAKGVRISVDSFQPQVIANSLSAGVEFINHIRGFVD
EESIREISKYARTNRKFILMYSHNHSNRAETKSHLTPNNVILEIVRFFRERKKILLNAGI
AQEQLIFDPGMGFFLSSDFQVSFEVLKKIKTLQEEFSPMMVSVTKKSFLGNALGGLKVEE
REIPTVIAELYLCIQNVEYIRTHEPKNLKQALKIWNLMNK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaacaagattcgaattcttcaagttattctacaaagatctttggggtattg
aatattaccgaagattcattttccgatggaggaaagtatcttacttttaaatcttcctct
gaaaaagcaaattctctgttaaaccaaggcgcagatgtaattgatataggcgctcagtct
tctaatattcaagcaagtttgatcggtcccgaaatcgaatggataagaatgaaggagtta
atttccaatttggttgcaaaaggagttcgtatttccgtagattcttttcaacctcaagta
attgctaattctttatctgcgggtgtggaatttattaatcatatccgaggctttgtagat
gaagaatctattcgagagatttccaaatatgccagaaccaatcgaaagtttattttgatg
tattctcataatcattccaatcgtgcggaaacaaaatcacatctaacaccaaataatgta
attttagaaattgtacggttttttcgtgaaagaaaaaaaattttattaaacgcgggaatt
gcacaagagcaattgatctttgatcctggaatgggtttttttctcagttctgattttcag
gtgagttttgaagtattaaaaaaaattaaaactctccaggaagagttttctccgatgatg
gtttcggttacaaaaaaatcatttttaggaaatgcgctcggaggtttgaaagtagaagaa
agagaaattcctaccgtaattgccgaactttatttatgtattcaaaatgtagaatatatc
cgaactcatgaacctaaaaatttaaaacaagctttgaaaatttggaatttaatgaataag
taa

DBGET integrated database retrieval system