KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0688Help
Entry
LIF_A0688         CDS       T01983                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
lie01130  Biosynthesis of antibiotics
lie01230  Biosynthesis of amino acids
Module
lie_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIF_A0688 (trpC)
Enzymes [BR:lie01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LIF_A0688 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ANF_receptor QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AER01495
Position
1:839063..839821
Genome map
AA seq 252 aa AA seqDB search
MSSSQPHRVLREIISTKQNEIKKISAWDPLPHRGLSLRDSLKSRTFSIIAECKRKSPSAG
ELRADYRPVQIAKTYEELGASAISVLTDQNYFGGSLEDLKDVSSELKIPVLRKDFILDEI
QIREARAFGASAILLIVRILTPEQIKSFLKLASSLGMDCLVEVHTSDEAKLALDCGAEII
GINTRDLDTFQIHQNLVEEVSAFLPPNIVKVGESGIKKRSDLDTFRKLVDAALIGTYFME
KQDIRKAWLNLF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctcaacctcaccgggttctccgggaaatcatttctacaaaacaaaatgaa
atcaaaaaaatttcagcctgggaccctcttccacatcgtggtctcagtcttcgtgattct
ttaaaaagtagaaccttttccattattgcagagtgtaaacgaaagagtccatcggcaggt
gaacttcgtgcggattatcgtccggttcaaatcgctaaaacatacgaagagttaggcgct
tctgctatttctgtacttacggatcagaattactttggaggttctttggaagatctgaag
gacgtctcttcagaattgaaaattccagttttaagaaaagattttattctggatgaaatt
cagattcgggaagcaagggctttcggtgcatccgcaattttattgatcgtcagaattttg
actccggaacagattaagtcttttttaaagttagcttcttctttgggaatggattgtttg
gttgaagttcatacttcggatgaggcgaaacttgctctggattgtggtgcggaaattatt
ggaatcaatacgagagatttagatacgtttcaaattcatcagaatttggtagaagaagta
tccgccttcttaccacctaacatagtaaaagtaggtgaatccggtataaaaaaacgttcc
gacttggacacttttcgtaaattagtggacgcggctttgatcgggacctattttatggaa
aaacaagatattcgaaaagcctggttgaatttattttag

DBGET integrated database retrieval system