KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0699Help
Entry
LIF_A0699         CDS       T01983                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIF_A0699 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LIF_A0699 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LIF_A0699 (proB)
Enzymes [BR:lie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LIF_A0699 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:850835..851707
Genome map
AA seq 290 aa AA seqDB search
MKPERNSLSEKIRNAEKIVIKVGSARLSGLPSEVNDFLFQLVSDIRHLRDLGKKVILVSS
GAIARGRLLLSELPSTISSGDSLAEKQALAAMGQNRLVNLYDSFFSKVNLSIAQILFGVL
DLESKEGYKNLKNTFTQLVEWGILPVVNENDSVATEEVKFGDNDMLSALVSLIVEADLLI
ILTGVDGFLKEEKVVPFLEKISKEDLGLAGGPSGPGTGGMFTKLKSAGLLSEAGIPTAIL
NGKKMHVIREFLEKNSIGTLVAPSGNRVFSEEDVKEIIRKNRNGNGGNSL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggaacgaaactcactttctgaaaagatccgtaacgctgaaaagatcgttatc
aaagtaggttcggcaaggctttctggacttccgtcggaagtaaacgattttctatttcaa
ttggtaagtgatattcgtcatcttagagatttaggaaaaaaggtgattttagtctcttca
ggagcgattgcaagaggaagacttttgttaagcgaacttccctctacaatttcttcgggg
gattcacttgccgaaaaacaagcgttagccgcaatggggcaaaataggcttgtcaatctc
tacgatagttttttttccaaagtcaatttgagcatcgcacagatcctttttggtgttttg
gatttggaatccaaagaaggttataaaaatctaaagaacacatttactcaacttgtagaa
tgggggatacttccagtagttaacgaaaatgattccgttgcaaccgaagaagtaaagttt
ggagacaacgatatgctttccgctttggtgagtttgatcgtagaagccgatcttttgatt
atacttacaggtgtggatggttttttaaaagaagagaaagttgtaccttttctggagaaa
atttctaaagaagatttaggtcttgctgggggtcctagtggacctggcacaggcggaatg
ttcactaaacttaaatctgcgggtttattatctgaggctggaattccgaccgcgatctta
aacggaaaaaaaatgcatgtgattcgtgaatttttagaaaaaaattcaataggaacatta
gttgctccttccggaaaccgcgttttttctgaagaggacgtaaaagaaatcatccgtaaa
aatagaaacggaaacggaggaaatagtttatga

DBGET integrated database retrieval system