KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0816Help
Entry
LIF_A0816         CDS       T01983                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LIF_A0816 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LIF_A0816 (btuE)
Enzymes [BR:lie01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LIF_A0816 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1012629..1013198
Genome map
AA seq 189 aa AA seqDB search
MKEGASFMYSKYFIWFMTLGIFLPLAGIFAKGSFYDFKVKDIKGNEVSLSKYKGKVVMVV
NVASKCGYTYQYEHLEKVYKKYKDQGFAVVGFPANNFGGQEPGTDQEIETFCRIQKGASF
DMMSKISVKGKDIHPLYSYLIQNSPNPGEVEWNFEKILISKNGTIEARYRSSVEPDSSAV
TQKIETLLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggagccagttttatgtattcaaagtatttcatttggtttatgactttagga
atttttttaccattagcggggatttttgcaaagggaagtttttatgatttcaaagtaaaa
gacatcaaaggaaacgaagtgtctctttctaaatataagggaaaggtagtgatggtggtg
aacgtagcttctaaatgtggttatacctatcaatacgaacatctcgaaaaagtttataaa
aaatataaggatcaaggatttgcagtagtaggttttcccgctaataattttggaggccaa
gaaccaggaaccgatcaagaaatcgaaacgttttgcagaattcaaaaaggtgcaagtttt
gatatgatgtctaaaatttcagtcaaaggaaaggatattcatcctttatattcttatctg
attcaaaattctccaaatccgggagaagtagaatggaatttcgaaaaaattttaatatca
aaaaatggaacaatagaagcgagataccgttcttctgttgagcctgatagttccgcagtg
actcaaaaaattgagactctcttaaagtga

DBGET integrated database retrieval system