KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0836Help
Entry
LIF_A0836         CDS       T01983                                 

Gene name
caiD
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LIF_A0836 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LIF_A0836 (caiD)
   00650 Butanoate metabolism
    LIF_A0836 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    LIF_A0836 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LIF_A0836 (caiD)
   00310 Lysine degradation
    LIF_A0836 (caiD)
   00360 Phenylalanine metabolism
    LIF_A0836 (caiD)
   00380 Tryptophan metabolism
    LIF_A0836 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LIF_A0836 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LIF_A0836 (caiD)
   00281 Geraniol degradation
    LIF_A0836 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LIF_A0836 (caiD)
   00627 Aminobenzoate degradation
    LIF_A0836 (caiD)
   00930 Caprolactam degradation
    LIF_A0836 (caiD)
Enzymes [BR:lie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LIF_A0836 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1042113..1042940)
Genome map
AA seq 275 aa AA seqDB search
MKTHFEFFEIVPKPEDKTAILYLNRPEKRNAMNWPFWRDLPDTIEEINSNPDIHSFVIAA
RGKSFSTGLDLDSFIQQFGSIIQAPLGSDRRKFFDLILKMQKGINAVYDSPKPSIAAVQK
HCIGGGLDLISACDIRYATVDASISLREAKVAIVADMGSINRLPSIIGQGHTRELALTGK
DIDGPEAERIGLVTKVFSTEEEMMNAALATAKEIAENPKIVVSGIKDVMRYSEGKPLDAG
LNYVALWNSSFLDSADFRGAMQSFRERKRPVYNQS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccattttgaattttttgaaatcgttccaaaaccagaagacaaaactgctatc
ctttatctcaacagacccgaaaaaagaaacgcaatgaactggcctttttggagagatctg
ccagatacaatcgaagaaattaactcgaatccggatattcattcgtttgtgatcgccgca
agaggtaaatctttctccaccggtttagatctggattcttttatccaacagttcggaagt
ataatccaagctcccttaggtagcgatcgaagaaagttctttgatctcattttaaaaatg
caaaaaggaatcaatgcagtttacgattcccctaaaccttccatcgcagcggttcaaaaa
cattgtatcggtggcggtttagatctgatctccgcctgcgatattcgttatgctaccgtg
gacgcgtctatctctcttagagaagcaaaagtagcgattgtcgcagatatgggttctatc
aacagacttccttctatcatcggacaaggtcatacaagagaattggccttaaccggaaaa
gacatagacggaccagaagcagaaaggataggacttgttactaaagtattttcaaccgaa
gaagaaatgatgaacgcagctcttgcaactgcaaaagaaatcgctgaaaatcctaaaata
gtcgtatccggaattaaagacgtaatgagatattctgaaggaaaaccgttagacgccggt
ttaaattatgttgctctttggaattctagctttttagattccgcagattttagaggagca
atgcaatcttttcgggaacgcaaacgccccgtctataatcaatcttaa

DBGET integrated database retrieval system