KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0917Help
Entry
LIF_A0917         CDS       T01983                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Brite
Enzymes [BR:lie01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LIF_A0917 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1135409..1136074)
Genome map
AA seq 221 aa AA seqDB search
MFSSSKVCNPILREQERKNMVDLQIASRGIRDKKILSAMLSIPRECFVPNSHILQAYEDK
PLPIGCNQTISQPFMVAWMSLLLEVRKGDRIFEIGTGSGYQSAVLIFLEATLYSVEFFDS
LSKTATQNLECWNPGCTQTNRFMIGSATEILKPELQFDKMISCAALPNLPDTKSSYFQSL
IPGGIFIFPMGKRDQYLIFAKRNLNDWSFESKGGVRFVPLL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttcgtctaaagtctgtaatccgattcttcgtgaacaagaaagaaaaaatatg
gtcgatcttcaaatcgcctctcgaggaattagagataaaaaaattctctctgcaatgctt
tcgattccaagagaatgttttgttccgaattcccatattttgcaagcatacgaagataaa
ccacttccaatcggttgtaatcaaaccatctctcagccgtttatggtagcatggatgtct
ttacttcttgaagttcgaaaaggagaccgtatctttgaaattggaaccggctcgggttat
caaagcgccgttttaatttttttagaagccacgttatactccgttgaattctttgactct
ctttctaaaaccgctactcaaaatttagaatgttggaatccaggctgtactcaaacgaat
cgttttatgatcggaagtgcgactgaaattctaaaaccggaacttcaatttgataagatg
atttcttgcgctgcacttccgaatcttccagatacaaaaagctcctactttcaatctctt
ataccgggaggaatttttatcttcccaatgggaaaacgagatcaatatttgatcttcgca
aaaagaaatctcaacgactggtcctttgaatccaaaggtggggttcgatttgttccttta
ctttaa

DBGET integrated database retrieval system