KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A0991Help
Entry
LIF_A0991         CDS       T01983                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LIF_A0991 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LIF_A0991 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    LIF_A0991 (aceF)
Enzymes [BR:lie01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LIF_A0991 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1223286..1224545
Genome map
AA seq 419 aa AA seqDB search
MSVEIKVPEMGESITEATIANWVKKEGESVKQDEILLELETDKATMEVPAPSSGVLQKIH
KKAGETVKVKEIIGLIDSSATASSPSTSAPTNSAQTTQTSGNGTINETLPPAVRKLIEDN
GLNPASITGSGKNGQITKEDVLKAIETKATSSVSNASVNVGTPAAVKATLTLPEIPKAVP
AARRTDLPRENVVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDKFKE
AHNVSLGFMSFFTKAAIHALKTIPAINAEIRGSDIVYKNYYDIGVAVGGPKGLVVPVVRD
ADLLSFAGVEQEIIRLANRVKDGKIELAEMEGGTFTISNGGIYGSMMSTPILNPPQSGIL
GLHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPSRLLLEL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaattaaggtccccgaaatgggggaatccattacggaagctacgattgca
aactgggtaaagaaagaaggagaatctgtaaaacaagacgagatcttgttagaactggaa
accgataaggcgaccatggaagttccggctccttcttcgggtgttcttcagaaaattcat
aaaaaggctggagaaaccgtaaaagtaaaggagatcatcggactgattgactcttcagca
actgcttcttctccttccacttctgctccaacaaattcagcacaaacgactcaaacatca
ggaaacggaaccataaacgaaactcttccgcctgcggtccgtaagttgatcgaagacaac
ggactcaatccggcatcgattactggttccggtaaaaacggacaaatcacaaaagaagac
gtattaaaagcaatcgaaacaaaagcgacgtcgtcagtttcaaacgcttccgtaaatgta
ggaactccagcggctgtcaaagcgacgctgactttacctgaaattccgaaagcggttccg
gctgcgagaagaacggatctaccaagagaaaacgtagttcctatgactcgacttcgtaag
gtaattgcagaaagacttgtatcggcacaacacaacgctgcaattctgaccacgtttaac
gaagtagatatgagtgccgtaatggaactcagaaatcgatataaggataaatttaaagaa
gcgcataacgtaagtcttggatttatgagcttttttactaaggctgcgatccatgcgcta
aaaacaattccggcgatcaatgcagaaatccgtggaagtgatattgtttacaaaaattat
tatgacataggggtcgctgttggaggaccgaagggactggtcgttcctgtcgtaagagac
gcggacttgctcagttttgcaggagtagaacaagagattataagacttgcgaatcgggtc
aaagacgggaaaattgaacttgctgaaatggaaggtgggacgtttacgatttccaatggg
ggaatctacggttctatgatgtccactccaattctcaatcccccacaaagtggaatttta
ggacttcataatatagtaaaacgtgctgtggtggtaaacgatcagatcgtgattcgtccg
atgatgtatcttgcactttcctacgatcatagaattgtagatggaaaagaggcggtcact
ttccttgtaaaggttaaggaagcgatcgaagatccaagtcggcttttactagaactttaa

DBGET integrated database retrieval system