KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A1015Help
Entry
LIF_A1015         CDS       T01983                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lie00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LIF_A1015 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    LIF_A1015 (cheB)
Enzymes [BR:lie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     LIF_A1015 (cheB)
Two-component system [BR:lie02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   LIF_A1015 (cheB)
Bacterial motility proteins [BR:lie02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LIF_A1015 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1252093..1253166
Genome map
AA seq 357 aa AA seqDB search
MIPNPVRAVIIDDSLLVRNIISDQIQKDSKIHVVATGKTGMDCIDLAQKMNPDVIILDVE
MPVMDGLTALHELQKKKLGIPVIMLSVLTQNGAEATFKALEYGAIDFVPKPSSVFQFDPE
EIGNILKSKILAYFESKIQIPSQNLLKKAPAYSKVPAGSHLKKSPIQAICIGTSTGGPRA
LQEVFSRIPADISLPILVVQHMPAGFTKAFATRLNDHAKIKVKEAEDGEPIEPNTGYVAP
GDAHLSIQSKGGRKWIALNREAPVNGHRPSIEVLLDSAIEEYKSGIIGVIMTGMGKDGSA
AIVRVREIGGSTIAQDEQTSVIYGMNRQAVEMGGVEYIEPVTEIINRIQIILKERGI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgattccaaatccggttcgtgcggttattatcgatgattctctattagtcagaaatatc
atctctgatcagatccaaaaagattctaagatccatgttgtcgcaaccggcaaaaccgga
atggattgtattgatcttgctcagaagatgaatccggacgtgattatactcgacgtagaa
atgccggttatggacggccttacggcacttcatgaacttcaaaaaaagaaattaggaatt
cctgtcattatgctttccgttttgactcagaatggagccgaagcaactttcaaggctttg
gaatatggagccattgattttgtaccgaaaccttccagtgtgtttcaattcgatccggaa
gaaattggtaatattttaaaatctaaaattttagcttacttcgaaagtaaaatacaaatt
ccttcccaaaatcttttaaaaaaggctccggcttattcaaaggttccagctggatcgcat
ttaaaaaaatccccgattcaagccatttgtataggtacttccactggaggacctagagcc
cttcaagaagtgttttccagaattccagcggacatttctttaccgattttagtcgttcaa
catatgcccgcgggttttacaaaagcgtttgcgactaggctgaacgatcacgcaaaaatc
aaagtaaaagaagcagaggatggtgagccgatagaaccgaacactggttatgtggcaccg
ggtgacgcacatctttccattcaatccaaaggagggaggaaatggattgccctgaacagg
gaagcccctgtaaatggacacagaccttccatcgaggttcttctagatagcgcgattgaa
gaatataaaagcggaattatcggtgtgattatgactgggatgggtaaagacggttctgca
gcgatcgtaagagttagagaaataggtggttctacgattgcacaagacgaacaaacttct
gttatttatgggatgaatcgtcaagctgtggagatgggaggcgtcgaatatattgagcct
gttacagaaatcatcaataggatccaaatcattttgaaagagagaggaatttaa

DBGET integrated database retrieval system