KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A1319Help
Entry
LIF_A1319         CDS       T01983                                 

Definition
dTDP-4-dehydrorhamnose epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:lie00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lie00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1627794..1628246
Genome map
AA seq 150 aa AA seqDB search
MNKVLLEGVVITSLKEIFDPRGSVLHMIRIDDPEYNGFGECYFSEINPRAVKAWKFHKKQ
TQNFTVPSGRIKLILFDPRENSKTKGKIQEIILGRPENYQRVKIPPQIWYGFTCISKEKA
LIANFTDIPHDPSEAERLPEHGSFIPFTWG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttcttttagaaggcgtagtaattacttcgttgaaagaaatattcgatcca
agaggatccgtactacatatgattcgtatcgatgatcccgaatacaatggattcggagaa
tgttatttttcggagattaatcctcgtgctgtaaaggcctggaagtttcataaaaaacaa
acgcaaaattttacggttccctctggtaggatcaaattgatactttttgatcctagagaa
aattcaaaaacaaagggaaaaattcaggaaatcattttaggaaggccagaaaattatcaa
agagttaaaatccctcctcaaatttggtacggttttacctgtatttctaaggaaaaagcg
ctcattgcaaattttaccgacatacctcatgatccatccgaagctgagcgtttgccagaa
catggttcattcattccatttacttggggctag

DBGET integrated database retrieval system