KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A1377Help
Entry
LIF_A1377         CDS       T01983                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00010  Glycolysis / Gluconeogenesis
lie00051  Fructose and mannose metabolism
lie00562  Inositol phosphate metabolism
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
lie01120  Microbial metabolism in diverse environments
lie01130  Biosynthesis of antibiotics
lie01200  Carbon metabolism
lie01230  Biosynthesis of amino acids
Module
lie_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lie_M00002  Glycolysis, core module involving three-carbon compounds
lie_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIF_A1377 (tpiA)
   00051 Fructose and mannose metabolism
    LIF_A1377 (tpiA)
   00562 Inositol phosphate metabolism
    LIF_A1377 (tpiA)
Enzymes [BR:lie01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LIF_A1377 (tpiA)
Exosome [BR:lie04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LIF_A1377 (tpiA)
  Exosomal proteins of bladder cancer cells
   LIF_A1377 (tpiA)
  Exosomal proteins of melanoma cells
   LIF_A1377 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3665
Motif
Other DBs
NCBI-ProteinID: AER02177
Structure
PDB: 

Jmol
Position
1:complement(1693052..1693804)
Genome map
AA seq 250 aa AA seqDB search
MRKTIIAGNWKMNLSLKEAVFLAHSIREKIPSISKDKVSMVFPSTLHLENVSKILEGSSV
IVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKN
EFTVLYCVGETLSERESGKTLEVLSSQIREGLKGIDSVFFSNLILAYEPVWAIGTGKVAT
PSQAQEVHSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGAS
QKISSFAELF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagacaattattgcaggaaactggaaaatgaatttatctcttaaagaagccgtt
ttcctagcacattcgatccgagaaaaaattccatccatttctaaagataaagtctcgatg
gtatttccttctactcttcatcttgaaaacgtttccaaaatattagaaggtagcagtgta
attgttggagcccaaaactgttatcactccggacttgcagcttttaccggcgaaacctct
cccgatcaactgaaagaaattggtgttaaagttgtaatggtcggtcattcggaacgtcgt
caatttttaggagagtctaactttttttgtaacgataaaatccgttttcttttaaagaac
gaatttacagtcctttattgtgttggagaaactctctccgaaagagaatccggtaaaaca
ttggaagtactgtcttctcaaattagagaaggtttaaaaggaattgatagcgtatttttt
tccaatttaattctggcttatgaaccagtttgggccattggaactggaaaagttgccacc
ccctctcaagcccaagaagtacattcttttattcgtaaagaaatttctggtctttttgta
ggcgcctcttctatttcagaatccatttctattctctacggtggttctgtaaaaccagac
aatattcaagatctattaaaagaaaaagatatagatgggggtttagttggaggagccagc
caaaaaatcagttccttcgctgaacttttctaa

DBGET integrated database retrieval system