KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A1653Help
Entry
LIF_A1653         CDS       T01983                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lie00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lie00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2018031..2019545
Genome map
AA seq 504 aa AA seqDB search
MKLTSLLLKFPEIKLKSFPSGKNPDSIEIEYIQSDSRKTNKNDIFCVADSIGSKKKEFIS
NAKASLILLRTDSNVLNDLLEVMNSSKIFLECEIDPEQLQGRIASFLLGHPSKDLDIVAV
TGTNGKTSLTNILFSLAKDQGINCGLIGTIGVKFGDRVIDTGYTTPDASSLNLILKEMKE
EGITTVFMEASSHGLKLGRMNGISVRAGVFTNLTQDHLDFHSDMEDYFESKFRLFEILDF
SKSTFAVLDYSAPNGSKLYHKILNRFPDLLIYALDDIYRKWKISDISLNLQGTSYVLGLP
GNQERKISTNLLGSFNVRNTALAFLTGIGIGLDLEKMSNSLEKIPQIPGRFQIIYSKDRS
RMAVVDYAHTPDALENIIRSVRDSQPKCLITLFGCGGDRDRTKRPKMARIAEELSDQVIL
TSDNPRTEKPETILDEIQTGFSSGFIPLLREVDRAKAIVEGISCLPEGGCLLVAGKGHEE
YQIIGKEKRHFSDVEEVQKAFGLF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaccagtcttctccttaaatttccagaaatcaaactaaagtcttttccttcc
ggaaaaaatccggattcaatcgaaatcgaatatattcaatcggattctagaaaaacaaac
aaaaacgatatattctgtgtagccgattctattggttccaaaaagaaagaatttatttcc
aacgcaaaagcttccctaattttactacgaaccgattcaaatgttttgaatgatctttta
gaagttatgaattcttccaaaatttttttggaatgtgaaatagatccggagcagctacaa
ggtagaatcgcatcttttcttttaggacatccttctaaagatttggatattgtagccgta
accgggacaaacggtaaaacttctttgacgaatattctattctcattagcaaaagaccaa
ggaatcaattgtggattgatcggaacaattggagttaagtttggagatagagtgatagat
acaggttatactacaccggatgcttcttctctcaacttaatactcaaagaaatgaaagaa
gaaggaatcactaccgtttttatggaggcaagttctcacggtctcaaattaggtagaatg
aacgggatttctgtaagggcaggagtatttacaaatcttactcaagatcacttagatttt
cattccgatatggaggattattttgaaagtaaatttcgtctttttgaaattttagatttt
tctaaatctacttttgcggttttagattactctgcgccgaatggcagcaaactatatcat
aaaattctaaatcgatttcctgatcttttaatatatgcgttagacgatatatatagaaaa
tggaagataagtgacatttctttaaacttacaaggtacttcctacgttttaggcttacct
ggaaaccaggaacgaaagatttcaaccaatctgctcggttcatttaacgttcgaaatacg
gctcttgcgtttttgaccggaattggtataggtttagatctggaaaagatgtctaactct
ctggaaaaaattcctcagattcctggaagatttcagatcatctacagcaaagatcgttcc
aggatggcggtcgtggattacgcacacactccggatgctctcgaaaatataattcgaagt
gtaagagattctcaacctaaatgtttgattactttgttcggatgtggaggagatcgggac
cgaaccaaacgtcctaaaatggctcgaatcgccgaagaactttccgatcaggtgatcttg
acctccgataatcctagaacggaaaaaccagaaacgattttagatgaaattcaaaccggg
ttttcctccggttttattccacttttacgggaagtagaccgtgcgaaagcaattgtagaa
ggtatttcttgtttacccgaaggagggtgtttacttgtggctggtaaaggacacgaagaa
taccaaatcattggaaaggaaaaacgtcatttcagtgacgtggaagaagttcaaaaagcg
ttcgggcttttttag

DBGET integrated database retrieval system