KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A2636Help
Entry
LIF_A2636         CDS       T01983                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00260  Glycine, serine and threonine metabolism
lie00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
lie01130  Biosynthesis of antibiotics
lie01230  Biosynthesis of amino acids
Module
lie_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LIF_A2636 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIF_A2636 (trpA)
Enzymes [BR:lie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LIF_A2636 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA DUF561 His_biosynth Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AER03411
Position
1:complement(3260138..3260932)
Genome map
AA seq 264 aa AA seqDB search
MNSISSVFSSEQSVFIPYISLGDPDYDSCVIWADALIRGGAGILELGIPFTDPVADGPVI
QKAFKRSLAHPFSMDKILEVTSEIHKLHPQIPLVYLTYFNPLFSMGLESFTERAKNSGIQ
GLIIPDLPFDTPEAEEFFSQLERKRIDFIHLVTPATTEDRIRSMKSLASGFIYYVTSYGV
TGERGSIASGLEDRIRMVRKIVGLPVCAGFGISTSDQSKVISTYADGVIIGSAVQRIIEE
NGSDRNNCADKLLAYASEIRASMR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaactccatttcttccgttttttcttcggagcaaagtgtttttattccttatatttct
ttgggtgatccggactatgattcctgcgttatttgggcggatgctttgattcgaggtggt
gccggcattttagaattgggaattccttttactgatccggttgccgatggtccagtgatt
caaaaagcttttaaacgttctttggctcatcctttttccatggataaaattttagaagtt
acttcggaaattcataaacttcatcctcagattcctctcgtatatcttacttattttaat
cctttgttctctatgggtttggaatcttttacggaaagagctaaaaattctggtatccaa
ggtttgatcattccggaccttccgtttgataccccggaggcggaagaatttttttctcaa
ctcgaaagaaagagaatcgattttatccatcttgtgactcctgctactacggaagacaga
attcgttcgatgaaatctcttgcgtccggttttatctactatgtgacttcctacggcgtt
accggggaaagaggttcgattgcgtctggtttggaagatagaattcgaatggtgcgtaag
attgtcggtcttccagtttgtgctggttttgggatttccacttcagatcaatctaaggtt
atttcgacttatgcagatggagtgatcatcggttctgccgtgcaaagaatcattgaagaa
aacggatctgatcgtaataactgtgcggataaacttctggcctacgcttctgagattcgt
gcttcgatgagatag

DBGET integrated database retrieval system