KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A2636Help
Entry
LIF_A2636         CDS       T01983                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIF_A2636 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LIF_A2636 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIF_A2636 (trpA)
Enzymes [BR:lie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LIF_A2636 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3260138..3260932)
Genome map
AA seq 264 aa AA seqDB search
MNSISSVFSSEQSVFIPYISLGDPDYDSCVIWADALIRGGAGILELGIPFTDPVADGPVI
QKAFKRSLAHPFSMDKILEVTSEIHKLHPQIPLVYLTYFNPLFSMGLESFTERAKNSGIQ
GLIIPDLPFDTPEAEEFFSQLERKRIDFIHLVTPATTEDRIRSMKSLASGFIYYVTSYGV
TGERGSIASGLEDRIRMVRKIVGLPVCAGFGISTSDQSKVISTYADGVIIGSAVQRIIEE
NGSDRNNCADKLLAYASEIRASMR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgaactccatttcttccgttttttcttcggagcaaagtgtttttattccttatatttct
ttgggtgatccggactatgattcctgcgttatttgggcggatgctttgattcgaggtggt
gccggcattttagaattgggaattccttttactgatccggttgccgatggtccagtgatt
caaaaagcttttaaacgttctttggctcatcctttttccatggataaaattttagaagtt
acttcggaaattcataaacttcatcctcagattcctctcgtatatcttacttattttaat
cctttgttctctatgggtttggaatcttttacggaaagagctaaaaattctggtatccaa
ggtttgatcattccggaccttccgtttgataccccggaggcggaagaatttttttctcaa
ctcgaaagaaagagaatcgattttatccatcttgtgactcctgctactacggaagacaga
attcgttcgatgaaatctcttgcgtccggttttatctactatgtgacttcctacggcgtt
accggggaaagaggttcgattgcgtctggtttggaagatagaattcgaatggtgcgtaag
attgtcggtcttccagtttgtgctggttttgggatttccacttcagatcaatctaaggtt
atttcgacttatgcagatggagtgatcatcggttctgccgtgcaaagaatcattgaagaa
aacggatctgatcgtaataactgtgcggataaacttctggcctacgcttctgagattcgt
gcttcgatgagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system