KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A2637Help
Entry
LIF_A2637         CDS       T01983                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lie01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lie00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lie00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3260929..3262122)
Genome map
AA seq 397 aa AA seqDB search
MGKENQQGYFGEFGGRYSPEILHDALVELETTYKKLKKNKHFKKELEYYRKNYIGRPSPL
TYAERLSKVWGGAKIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQHGVA
TATVGAMFQMETVVYMGEEDLRRQELNAIRMRMLGAKVVGVSSGTATLKDATSEAMRDWA
LNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVNDKLPNAVIACVGGGSNAI
GMFYGFIQDKKVKLFGVEAGGYSSDPGSHSATIQFGRTGFLHGTKTLVIQDDFGQIVPAH
SVSAGLDYPGVGPEHAYFHKSGRVEYVNVDDEGALDAFIEVCRIEGIIPALETAHAFRYA
KDLARTMSKKENILICLSGRGDKDVAEVSRLRKGEFI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaaaatcaacaaggctactttggagaatttggcggtcgttattctcctgaa
attcttcacgatgctctcgtagaacttgaaacgacttataaaaagctcaagaagaacaaa
cactttaaaaaagaactagaatactatcgtaaaaattatatcggtcgtccttctcctctt
acttatgcggaacgtctttctaaggtttggggcggcgctaaaatctggctcaaacgcgaa
gatttaaatcatactggagcgcataagatcaataatacgatcggtcaggttttgattgct
aaggctatgggtaaaactagaatcattgcggaaaccggcgccggtcaacacggcgttgca
actgcaaccgtaggcgctatgttccagatggaaaccgtagtttatatgggtgaagaagac
ttaagacgtcaggaactcaatgcgatccggatgagaatgttgggcgctaaagtcgtaggt
gtttccagtggtaccgctactctcaaagacgcgactagcgaagcgatgagagactgggca
ttaaatgtttctaatactcattatattgtgggttcttctatcggtccacatccgtttcct
acgattgtcagagacttccaatctgtgatcggtattgaatctagaaaacagtttaaaaaa
gtaaacgataaacttccaaacgccgtgattgcttgtgtcggcggcggctcgaacgcgatc
ggtatgttttacggttttattcaggataaaaaagttaaactctttggtgtagaagccggt
ggttattcttccgatcctggttctcattctgctaccattcaatttggtagaaccggtttt
ttacacggtactaaaactttagtgattcaagacgattttggacagatcgttcccgctcat
tccgtttctgctggattggattatcctggtgttggtccggaacacgcttactttcacaaa
agtggtagagttgaatacgttaacgtagacgacgagggagcgttagacgcgtttattgaa
gtttgtagaattgaaggtattattcccgctttggaaactgcgcatgcgttccgttatgcg
aaagatctggcaagaactatgagcaaaaaagagaatattctgatttgtctttccggtaga
ggtgacaaggacgtggcagaggtttctagacttagaaaaggagaatttatttga

DBGET integrated database retrieval system