KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A2688Help
Entry
LIF_A2688         CDS       T01983                                 

Gene name
adhP
Definition
Zn-dependent alcohol dehydrogenase
Organism
lie  Leptospira interrogans serovar Lai IPAV
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3320658..3321689)
Genome map
AA seq 343 aa AA seqDB search
MKAAVLESGKKILEIRDVSVPQLRAEQVKVRIKACGICGSDVHLVVHGTLKCKHFPRVPG
HESSGIIEEVGENVRRFRKGDRVVIAAGTSCGVCSYCKEGKENLCKDLGVFGFDRDGSFA
EFNIVEERYLYSLPDEIPFDQGAILADAVSTPYHAIRYRGNIQESDTVAIFGCGGLGIHA
VAIARAMTKGKVIALDVDSGALENATKYGADEVVNLKEVRNSGKVLKEVSKGVDLLADFS
GYMSNVEDSIRAMNPGGRIVLVGIGRQPLKFQIPFILIEKMISVSGSYGSDRRAIPELIE
LYLKGKINLSHSITSHHPLEELNECLEALDQRKGNPIRFIVEP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggttttagaatccggtaaaaaaattttagagatcagagatgtttccgtt
ccacaacttagggctgaacaagtaaaggtaagaattaaggcttgtggtatttgtggttca
gacgtacatctcgtggttcatggaactctcaaatgtaaacattttcccagagttccagga
catgagtcatcgggaattatcgaagaagtaggcgagaacgttagacgattccgtaaagga
gatcgagtggtcatcgcggccggaacttcatgtggagtttgttcttattgtaaagaagga
aaagaaaatctatgtaaagatttaggggtgtttggttttgatcgagatggaagttttgca
gaatttaatatagtagaagaacgttatttgtattctcttccagatgagattccatttgat
caaggagcgattcttgcagatgctgtatctactccttatcacgctattcgttacagaggg
aatattcaggaaagtgatacagtagctatttttggttgtggggggcttggaatccatgcg
gtggcgattgcaagggcgatgacaaaaggtaaggtgattgcattggatgtggattcggga
gctttagaaaacgctaccaaatatggagctgatgaagtggttaacttgaaagaagttcga
aattcgggcaaggttctaaaggaagtatcgaaaggtgtagatctacttgccgacttttcg
ggttatatgtctaacgtagaagattcaatacgagcgatgaacccgggaggtagaattgta
cttgtaggtattggaagacagcccttgaaatttcagattccttttatattaattgaaaaa
atgatttctgtttctggttcttatggatccgatcgtagagcgattcctgaattgattgaa
ctttatctaaaaggaaaaatcaatctttctcattcgattacttctcatcatccattagaa
gaattgaatgaatgccttgaggccttggatcagagaaaaggaaatccgattcggtttatt
gttgaaccttaa

DBGET integrated database retrieval system