KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A2818Help
Entry
LIF_A2818         CDS       T01983                                 

Gene name
mauG
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Brite
Enzymes [BR:lie01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LIF_A2818 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3477549..3478568)
Genome map
AA seq 339 aa AA seqDB search
MNRIFIASFLILNSLLTLSCKDEKKEVVRKDDQTKRLEIASYPFPPDNVPTPERILLGKT
LFFDPIVSGSNWISCASCHNPGLAWTDGLKTAVGHNMKILGKNTPTILNGAYGNKMFWDG
RADNLEEQALGPITSPDEMNQNMEELILELKNIPGYKNLFSKAYPSEEISAATIGKAIAS
FERTIFSTESAFDRWKKGDKAALSESAQRGFTVFNGKANCSSCHQGEQFSDNGFHNIGLK
NAVKEVGRFKIVPVKSMKGAFKTPGLRDVALTGPYMHDGSYTTLEEVIEHYDRGGDEKNN
LDPNMLALKLTDQEKTDLVEFMKSLSGKRVSITIPEFPR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcgaatttttatagcctcgtttttaattctcaactcacttttgactctatcttgc
aaagacgaaaaaaaagaagtcgttcgtaaagacgatcaaacaaaaagactagagatagct
tcttacccttttcctccggataatgttccgactccggagagaatcttgctcggaaaaaca
ctgttttttgatccgattgtatctggttctaattggatcagttgtgcttcttgtcataat
cctggacttgcttggacggacggacttaaaacagctgttggacataatatgaagatttta
ggaaaaaatactcctacgattctcaatggtgcatatggaaataaaatgttttgggacgga
agggcggataatttggaagaacaggctttgggcccgatcacttctccggacgaaatgaac
cagaatatggaagaacttatattagagttaaagaatattccgggatataaaaatctgttt
tctaaagcgtatccaagcgaggaaattagtgcggctacgattggaaaggcgatcgcgagt
tttgaaagaacgatcttttctacggagtcggcctttgatcgttggaaaaaaggggataaa
gccgcgctttctgaatcggctcaaagaggttttaccgtatttaatggaaaagcaaattgt
tcttcttgccatcaaggggaacaattttcagataatggatttcataatataggtttaaaa
aatgcagttaaagaagtcggaagatttaaaattgtgccggtaaaatctatgaaaggcgct
tttaaaactcccggactgcgagacgttgccttaacggggccatatatgcacgacggaagt
tatacaacattagaggaagtgatcgaacattatgatcgaggtggggacgaaaaaaataat
ttggatccaaatatgctcgcacttaaacttacagatcaagaaaaaacggatcttgtagag
tttatgaaatccttaagtggtaaaagggtttcaattacgattcctgagtttccaagataa

DBGET integrated database retrieval system