KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3005Help
Entry
LIF_A3005         CDS       T01983                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LIF_A3005 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LIF_A3005 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LIF_A3005 (thrC)
Enzymes [BR:lie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LIF_A3005 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3734428..3735777)
Genome map
AA seq 449 aa AA seqDB search
MISTFTRYKAEFECINDSCKTRYDLNEIIYECKKCGSLLQVSHDLDALKSVSGQEWKDLF
DSRFRSVKFPNSSGIWNKREWVLPHIEDKNIVTSGEGLTHLFTSDRLTESLGLGSFYVKQ
CGISHTGSFKDLGMTVLLSQVKQMISSGVPIRAVACASSGDTSAALASYAAKAGIPAIIF
LPAGKVSQAQLIQPVSNGAKVIALDTDFDGCMKIVKEVTREAGIYLANSMNSLRIEGQKT
ISVEITQQLGWKVPDWIVIPGGNLGNVSALGAGFEMMFSLGLIDKLPRIVLAQAEHANPL
YLSYLKNFESFEPVSAKTTLASAIQIGNPVSIQKAIKTLKKFNGVVEQASESELADAASK
ADLFGLYNDPHTGVALAALEKLIQKGTISKGESVVVISTAHGLKFTEFKLKFHGGEIPGT
DFKIVNSIHKVEPKADKVVGLIRDLLVSK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgatctctacttttactcgatacaaagctgaatttgaatgtatcaacgattcctgtaaa
accagatatgatctaaacgaaatcatttatgaatgtaaaaagtgcggaagtcttctccaa
gtttcccacgatttagatgcgttaaaatctgtatccggacaggaatggaaggatctgttt
gatagtagatttcgttctgtcaagtttcccaattcttccggaatttggaacaaaagagaa
tgggttcttcctcatatcgaggataagaacattgtaacttcaggtgaaggtcttactcat
ctttttacttcggatcgattgaccgaaagtcttggactcggaagtttttatgtgaaacag
tgtgggatctcacacactggatcttttaaagatttaggaatgactgttttattatctcaa
gtaaaacagatgatttcttctggggttccgattcgtgcagtggcttgtgctagttcggga
gatacttcggccgctttagcatcttacgccgcaaaggcgggaattcctgcgattatattt
ttacctgcgggtaaagtgtctcaagcgcaactgattcaaccagtatctaacggtgctaag
gtgatcgcacttgatactgactttgacggttgtatgaaaatcgtcaaagaagtaactcga
gaagctggaatttatttagcaaactcgatgaactctttacggattgaaggacaaaaaacg
atttcagtggaaatcactcaacagttagggtggaaggttccggattggatcgtaattccg
ggtggaaatttaggaaacgtatctgcgttaggtgctggtttcgagatgatgttttctttg
gggctgatagataaacttccgaggatcgttttagcacaagcggaacacgcaaatcctctt
tatctttcttatttaaagaattttgaaagttttgaaccggtttctgcaaaaacgactctt
gcttctgcgattcaaattggaaatccggtttcgattcaaaaggcgatcaaaactcttaaa
aagttcaatggggttgtggaacaggccagcgaatcggagttagccgatgcggcctctaaa
gcggacttattcggtttatacaatgatcctcatacgggtgtggctttggcggctttggaa
aagttgattcaaaaaggaaccatttctaaaggtgagagtgtagtagtcatttcgactgct
cacggattgaaattcacagagtttaagttgaaattccacggaggtgaaattcctggaacg
gattttaaaattgtaaattcaattcataaggtagagcctaaagcggataaagtagtcggt
ttaattcgggatttattagtttcaaaataa

DBGET integrated database retrieval system