KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3195Help
Entry
LIF_A3195         CDS       T01983                                 

Definition
choline dehydrogenase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    LIF_A3195
Enzymes [BR:lie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     LIF_A3195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3992592..3994160
Genome map
AA seq 522 aa AA seqDB search
MSKDNTRYDAIVIGSGFGGSISALRLSEKGQRVLVLERGKKYSPGDFPRDVRKIDNLLWR
YPKKKKSLGLYELNFFSGLGTVTASGLGGGSLIYANIHIRPDHKVFEDPRWPAPFNRDYL
DPYFDKVASKFDVKPVPPEWDLPKRNRFKAAADLNRHTHFDPDAAASWLKPSRPGQSTCI
RCAECEFGCNHGAKNTLDFNYIADAEKNGAVFQTNSLASHIAPDSQNGYVVYYENTETGE
KKSVYAKRVILSAGTLGTNRILFNSRDRYKTLPNLSKQLGKGYSGNGDFLGGIESSKSEL
IPWDGPDVTTVINYFPQGFQFTMAAPTFSQPVMSVLASLGIAKPNWFLKLIGPIFWKSLK
WILPFVFKKGLLSKPLPPGLPGAGNPNYMTNLFAIGRDNANGKIVRRGKNIDVKWKYSKE
NQTLIQNMTASMQQIGDAYGGQFGPLATFLLFNRIISVHSLGGCILSANPDKGVVSETGE
VFGYKNLFIADGSVIPSSIGFHPVMTISAVAEHTAASICAGL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagataatactcgttacgacgcaatcgttattggctctggatttggtggttcc
atcagcgccttaagactttcagaaaaaggccaaagggttttagtattagaaagaggaaaa
aaatattctcccggagattttccaagggacgtacgtaaaatagacaatcttctctggcgt
tatcccaaaaagaaaaagtctttgggtttatacgaactcaatttttttagtggactcgga
accgtaaccgcttccggtttaggcggaggttccttgatctacgcgaatattcatatccgt
cccgatcataaggtttttgaagatcctcgctggccagctccgtttaacagagattatttg
gatccctattttgataaagttgcctctaaatttgatgtaaaaccggttccaccagaatgg
gatcttccaaaaagaaatagatttaaagccgctgcggatttaaacagacatactcatttt
gatccggatgcagctgcaagttggctaaaaccttccagaccaggacaatctacttgcata
cgttgtgcggaatgtgagttcggatgtaatcacggagctaaaaacacattagattttaat
tatattgcagacgccgaaaaaaacggtgccgtgtttcaaaccaattccctagcatctcat
atagccccagatagccaaaacggttacgtagtttattatgaaaatacggaaaccggagag
aaaaaatcggtatatgctaaaagagtcatactttccgcaggaacattaggtacaaataga
attctttttaacagcagagacagatacaaaaccctaccaaatctaagcaaacaacttgga
aaaggatattctggaaatggggactttttaggcggaattgaatcgagtaaaagtgaactc
ataccttgggacggaccggacgtaactaccgtaatcaattattttccacaaggatttcaa
tttacaatggcagcgcctacgttcagccaaccggtaatgtcagtacttgcttcattagga
attgctaaaccgaattggtttttaaagctgattggtcctatcttttggaaaagtttgaaa
tggattcttccttttgtatttaaaaaaggattactttccaaacctctaccacctggtctt
ccgggagcgggtaatccaaactatatgacaaatctatttgccataggaagagacaatgca
aatgggaaaatcgtacgtcgtggcaaaaacatagacgtgaagtggaagtattctaaagaa
aaccaaaccctcattcagaacatgactgcttctatgcagcagataggagacgcatacggc
ggacagttcggtccgttagctacctttttgttattcaatcggatcatctcagttcattct
ttaggaggttgtattctttccgccaatccggacaaaggagttgtatccgaaacgggagaa
gtattcggttataaaaatctattcattgccgatggatctgtaattccttcttcaatcgga
tttcatcctgtgatgacaatttccgccgtggccgaacatactgcagcttccatctgtgcc
ggattataa

DBGET integrated database retrieval system